I-TASSER results

I-TASSER results for job id Rv3689

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Input Sequence in FASTA format

>protein (451 residues)
MHKRYAPQRPKPDTETYIEKCTDRRQDGGHDERRQLLRPVSMLPPGYPVEPPPVAPGYAP
AGYPPYPATPPGYGPPGYGAPPSYGPPPGYGPPLGYPAAPPGCGPPPGYGPPLGYGPPVA
PGAVKPGIIPLRPLTLSDIFNGAVGYIRANPKATLGLTAMVVVTLQIISLVALFGPMTAF
GDIVTGEPDELTGAVVGGWSASFGASLLVSWLAGVLLSGMLTVIVGRAVFGSPITVGEAW
AKVRGRLLALFGLALLEAAGVVAVLGLAVVILSGVAAAANEAAAALLGFPLLLVVGVSLA
YLYVVLLFAPVLIVLERLPIVEAITRSFALVRHGFWRVLGIRLLTVLVVGVVGNAIAAPF
MIVGEIVTAVTASDGSVTMRLVGATLSAIGVTIGQIVTAPFSAGVVVLLYTDRRIRAEAF
DLVLQTGLEAGPAGGPAPVESTDNLWLTRPF

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 180 200 220 240 260 280 300 320 340 360 380 400 420 440 \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| MHKRYAPQRPKPDTETYIEKCTDRRQDGGHDERRQLLRPVSMLPPGYPVEPPPVAPGYAPAGYPPYPATPPGYGPPGYGAPPSYGPPPGYGPPLGYPAAPPGCGPPPGYGPPLGYGPPVAPGAVKPGIIPLRPLTLSDIFNGAVGYIRANPKATLGLTAMVVVTLQIISLVALFGPMTAFGDIVTGEPDELTGAVVGGWSASFGASLLVSWLAGVLLSGMLTVIVGRAVFGSPITVGEAWAKVRGRLLALFGLALLEAAGVVAVLGLAVVILSGVAAAANEAAAALLGFPLLLVVGVSLAYLYVVLLFAPVLIVLERLPIVEAITRSFALVRHGFWRVLGIRLLTVLVVGVVGNAIAAPFMIVGEIVTAVTASDGSVTMRLVGATLSAIGVTIGQIVTAPFSAGVVVLLYTDRRIRAEAFDLVLQTGLEAGPAGGPAPVESTDNLWLTRPF
Prediction	CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
Conf.Score	9888899999999888988999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999888888888877778899999999999989999999999999999999999999877665545678776555678899999999999999999999999999999999889989999999999999999999999999999999999999999987655689999999999999999999999999999999874887999999999998565789999999999999999999999999999998754677765578999999999999999999999999999999976666655545899988756788899987777777777889
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 180 200 220 240 260 280 300 320 340 360 380 400 420 440 \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| MHKRYAPQRPKPDTETYIEKCTDRRQDGGHDERRQLLRPVSMLPPGYPVEPPPVAPGYAPAGYPPYPATPPGYGPPGYGAPPSYGPPPGYGPPLGYPAAPPGCGPPPGYGPPLGYGPPVAPGAVKPGIIPLRPLTLSDIFNGAVGYIRANPKATLGLTAMVVVTLQIISLVALFGPMTAFGDIVTGEPDELTGAVVGGWSASFGASLLVSWLAGVLLSGMLTVIVGRAVFGSPITVGEAWAKVRGRLLALFGLALLEAAGVVAVLGLAVVILSGVAAAANEAAAALLGFPLLLVVGVSLAYLYVVLLFAPVLIVLERLPIVEAITRSFALVRHGFWRVLGIRLLTVLVVGVVGNAIAAPFMIVGEIVTAVTASDGSVTMRLVGATLSAIGVTIGQIVTAPFSAGVVVLLYTDRRIRAEAFDLVLQTGLEAGPAGGPAPVESTDNLWLTRPF
Prediction	7455242652525444434545544442344354444414443342414523333111201232343432221123112231121111011111221123222111122222222222222232324224244232331031002101420100000002320311221112120111212312244343232221112233333222213320001020100000100244422012003302320111011122332332233232122220111133332122113333323332222230010000000000522013003100300242100000032133223333332223233321100112223322000113233311212232112110320110000000000132011100131244455444332521412214336
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440

                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
MHKRYAPQRPKPDTETYIEKCTDRRQDGGHDERRQLLRPVSMLPPGYPVEPPPVAPGYAPAGYPPYPATPPGYGPPGYGAPPSYGPPPGYGPPLGYPAAPPGCGPPPGYGPPLGYGPPVAPGAVKPGIIPLRPLTLSDIFNGAVGYIRANPKATLGLTAMVVVTLQIISLVALFGPMTAFGDIVTGEPDELTGAVVGGWSASFGASLLVSWLAGVLLSGMLTVIVGRAVFGSPITVGEAWAKVRGRLLALFGLALLEAAGVVAVLGLAVVILSGVAAAANEAAAALLGFPLLLVVGVSLAYLYVVLLFAPVLIVLERLPIVEAITRSFALVRHGFWRVLGIRLLTVLVVGVVGNAIAAPFMIVGEIVTAVTASDGSVTMRLVGATLSAIGVTIGQIVTAPFSAGVVVLLYTDRRIRAEAFDLVLQTGLEAGPAGGPAPVESTDNLWLTRPF

5ijoJ

0.10

0.98

0.95

MUSTER

VLTSLTLGNQQDTACEVLADPSLPELFWGTEPTSGLGIILDSVCGMFPHLLSPLLQLLRALVSGKSTAKKVYSFLDKMSFYNELYKHKPHDVISHEDGTLWRRQTPKLLYPLGGQTNLRIPQGTVGQVMLDDRAYL-EYSYSSWTLFTCEIEMLLHVVSTADVIQHCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRLTTVISPPVDVIASCVNCLTVLAARN-----PAKVWTDLRHGYGNLLMNSEQPQGEYGVTIAFLRLITTLVKGQLGSTQSQ--GLVPCVMFVLKEMLPSYHKRYNSHGVREQ-CLILELIHAILNLCHETDLHSSHTPSLQFLCICSLAYTGQTVINIMGIGVDTMVMAAGQGQGQLLIKTVKLAFSVTNNVIRLKPPSNVVSPLEQALSQHGAGNNLIAVLAKYIYPALPRLAIQLLKRLATVAPM

4n7wA

0.10

0.07

0.68

0.73

dPPAS

---------------------------------------------------------------------------------------------------------------------------------MLVKITRLFPVWALLLSVAAYFRPTTFTGIGPYVGPLLMLIMFAMGVTLRLDDFKRVLSRPAPVAAATFLHYLIMPLTAWILAMLFRMPPDLSAGMVLVGSVASGTASNVMIYLAKGDVALSVTISAVSTLVGVFATPLLTRLYVDATISVDVVGMLKSILQIVVIPITAGLVIHHTFTKTVKRIEPYLPAMSMVCILAIISAVVAGSQSHIASVGFVVIIAVILHNGIGLLSGYWGGKLFGFDESTCRTLAIEVGMSGLAATLGKIYFSPLAALPGALFSVWHNLSGSLLAGYWSGKPVKKDQE-----------------

4mrnA1

0.11

0.07

0.64

0.93

wdPPAS

-------------------------------------------------------------------------------------------------------------------------------NPKDARHDGWQTLKRFLPYLWDNAVLRRRVVGAILVLLGKATTLALPFAYKKAVDATLGGGAQPALTVALAFVLAYALGRFSGVLFDNLRNIVFERVGQDATRHLARRTGEVTKVIERGTKSIDTLYFLLFNIAPTVIELTAVIVIFWLN-LGLVTATILAVIAYVWTTRTITEWRTHLREKNRLDGQALARAVDSLL--YETVK-YADAAVKSENSLGLLNIAQALIVNLLAGAAWTVYGWSQGKLTVGDLVFVNTYLTQLFRPLDLGVYRTIRQGLIDAEFRLIDTHIE---------------------------------

5l7dA

0.09

0.99

1.08

wMUSTER

PPLSHCGRAAP-RYNVCLGSVLPYGALLAGDSDSQEESGLRNAPNDRVELPSRTAIGWPDFTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFARREIVCRADGLGEPTSNETLSCVIIFVIVYYALMAGFVWFVVLTYAWHTSFKALQ-PLSGKTSYFHLLTWSLPFVLTVAILAVYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMR-GFDILVGQIDDALKLANEVKEAQAAAEQLKTTRNAYIQKYLERARSTLSKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAE-FRDYVLCQANVTIGLPTKQPIPDCEI--NRPL

4kjsA

0.11

0.07

0.64

1.51

wPPAS

---------------------------------------------------------------------------------------------------------------------------------------AGVPLSVIGSLMHWPSAVLFAVYCVTIIALASYMGRATESLSIRIGGLLNATFGNAVELIISMFALKETGIVLASLTGSVLGNLLLVAGLSFFVGGLKYARQEFNIHDARHNSGLLIFAIIVAFVIPEVFSVGMGNASKLNLSIGISIIMILLYVAALYFKGKVATIVLFAATIVVAYISE--HTFHSVAEQFGWS-----ELFIGVIIVAIVGNAAEHASAIIMAFKMDIAVEIAVGSTLQIAMFVAPVLVICSIFLPELVAMVSAVLLMIAISNDGDSWFEGA-AYVIMAIG---------------FFLL---

4w6vA2

0.09

0.05

0.54

1.02

dPPAS2

----------------------------------------------------------------------------------------------------------------------------------------GRWVTAIMAVVVVIIALISQGVIPPVMIASLLVYVIAASVTLYFIYLFAFAKMSRKDRARLLVCFILLVSAAFFWSAFEQKPTSFNLFANDYTDRMVMGFIILLAPVFSWAPSSITKFVIGILCAAAGFAVMMYAAQHVLSSGGAGVSPLWLVMSILLLTLGELCLSP---IGLATMTLLAPDRMRG-------------QVMGLWFCASSLGNLAAGLIGG------------HVKADQLDMLPTLFARCSIALVICAAVLILLIVPIRRLM------------------------------------------

4kjsA

0.11

0.07

0.66

1.53

PPAS

--------------------------------------------------------------------------------------------------------------------------------IFFILVAAGVPLSVIGSLMHWPSAVLFAVYCVTIIALASYMGRATESLSIRIGGLLNATFGNAVELIISMFALKETGIVLASLTGSVLGNLLLVAGLSFFVGGLKYARQEFNIHDARHNSGLLIFAIIVAFVIPEVFSVGMGNASKLNLSIGISIIMILLYVAALYFKSGKVATIVLFAATIVVAYISENHTFHSVAEQFGW------ELFIGVIIVAIVGNAAEHASAIIMAFKMDIAVEIAVGSTLQIAMFVAPVLVICSIFLPELVAMVSAVLLMIAISNDGDSWFEGA-AYVIMAIG---------------FFLL---

5k47A

0.08

0.07

0.92

1.06

Env-PPAS

MSQLFLDTPVSKTEKTNFKTLSSMEEGSLLDGLYWKMQPDNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRT--REETAAQVASLKKNGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRS--------FWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGFQECIFTQFRIAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQAEMELSD-------------------------

5l7dA

0.10

1.00

0.91

MUSTER

PPLSHCGRAAPLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGNDRVELPSRGWPDFLRCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFARREIVCRADGTMRLGEPETLSCVIIFVIVYYALMAGFVWFVVLTYAWHTSFKALPLSGKTSYFHLLTWSLPFVLTVAILAVAQYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAGFDILVGQIDDALKLANEVKEAQAAAEQLKTTRNAYIQKYLERARSTLSKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAE-SFRDYVLCQANVTIGLPTKQPIPDCEIKNRPS

4kjsA

0.10

0.07

0.67

0.72

dPPAS

--------------------------------------------------------------------------------------------------------------------------------IFFILVAAGVPLSVIGSLMHWPSAVLFAVYCVTIIALASYMGRATESLSIRIGGLLNATFGNAVELIISMFALKETGIVLASLTGSVLGNLLLVAGLSFFVGGLKYARQEFNIHDARHNSGLLIFAIIVAFVIPEVFSVGMGNASKLNLSIGISIIMILLYVAALYFKSGKVATIVLFAATIVVAYISENLVHTFHSVAEQFGWSELFIGVIIVAIVGNAAEHASAIIMAFKNKMDIAVEIAVGSTLQIAMFVAPVLVICSIFFLPELVAMVSAVLLMIAISNDGDSWFEGATVIMAIGFFLL--------------------

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-2.27

Estimated TM-score = 0.45±0.14

Estimated RMSD = 12.5±4.3Å

Download Model 2

C-score=-2.16

Download Model 3

C-score=-3.62

Download Model 4

C-score=-3.24

Download Model 5

C-score=-4.51

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	5l7dA	0.885	3.20	0.090	0.980
2	4jkvA	0.581	2.40	0.067	0.623
3	4z34A	0.552	3.96	0.079	0.663
4	4ntjA	0.523	4.16	0.092	0.650
5	4rnbA	0.494	4.69	0.076	0.627
6	3oduA	0.485	4.36	0.067	0.594
7	4ib4A	0.484	4.19	0.071	0.594
8	2ziyA	0.478	4.15	0.062	0.574
9	4zwjA	0.474	5.00	0.058	0.599
10	3v2wA	0.473	4.66	0.068	0.594

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.04	2	5cxvA	Y01	Rep, Mult	144,152,157,160,164,209,246,250
2	0.04	2	4qinA	SG8	Rep, Mult	111,112,113,114,190,192,409,412,416,419,421,450
3	0.04	2	1c6gA	KR	Rep, Mult	311,314,315,323
4	0.04	2	2uumA	BLA	Rep, Mult	324,328
5	0.04	2	5d6lA	CLR	Rep, Mult	134,135,138,139,171
6	0.04	2	4qimA	A8T	Rep, Mult	106,111,113,122,173,265,409,412,416
7	0.04	2	1c61A	KR	Rep, Mult	318,321,324,325,328,346,349,350
8	0.02	1	3oe6A	OLC	Rep, Mult	127,128,131,132,135
9	0.02	1	5l7dA	CLR	Rep, Mult	27,102
10	0.02	1	3kifD	GDL	Rep, Mult	444,446
11	0.02	1	2wbjF	UUU	Rep, Mult	448,449
12	0.02	1	3lw51	CLA	Rep, Mult	365,389
13	0.02	1	2i37A	UUU	Rep, Mult	308,311,312,331,332,333
14	0.02	1	1s5lK	CLA	Rep, Mult	151,155
15	0.02	1	1bjyA	CTC	Rep, Mult	424,428
16	0.02	1	2xquA	CVM	Rep, Mult	326,330
17	0.02	1	4n4wA	SNT	Rep, Mult	122,166,173,211,212,215,273,402,405,409
18	0.02	1	1c6dA	KR	Rep, Mult	209,212,213,249,272
19	0.02	1	2wieB	CVM	Rep, Mult	347,348

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	3h0gA	0.329	7.62	0.024	0.561	2.7.7.6	NA
2	0.060	2yyjA	0.313	5.84	0.040	0.437	1.14.13.3	NA
3	0.060	3b8eA	0.347	6.91	0.033	0.554	3.6.3.9	NA
4	0.060	3ikmD	0.325	7.12	0.058	0.541	2.7.7.7	NA
5	0.060	1b8fA	0.334	6.57	0.061	0.501	4.3.1.3	NA
6	0.060	1xmeA	0.317	5.29	0.042	0.421	1.9.3.1	NA
7	0.060	2ztgA	0.307	6.86	0.055	0.490	6.1.1.7	363
8	0.060	1jtnA	0.153	5.55	0.020	0.215	3.2.1.17	NA
9	0.060	1fftA	0.343	5.21	0.059	0.452	1.10.3.-	NA
10	0.060	2ohyB	0.324	6.40	0.056	0.474	5.4.3.6	NA
11	0.060	2o6yA	0.308	6.28	0.070	0.466	4.3.1.-	NA
12	0.060	2iukB	0.300	6.33	0.046	0.444	1.13.11.12	NA
13	0.060	2hc8A	0.117	5.01	0.051	0.157	3.6.3.-	NA
14	0.060	1m56A	0.348	5.26	0.045	0.457	1.9.3.1	NA
15	0.060	2vkzG	0.337	7.84	0.063	0.599	2.3.1.38,3.1.2.14	NA
16	0.060	3g61A	0.353	6.22	0.050	0.523	3.6.3.44	NA
17	0.060	3d4sA	0.439	4.68	0.056	0.548	3.2.1.17	223
18	0.060	3a1cB	0.165	6.11	0.050	0.244	3.6.3.-	365,374
19	0.060	1u8vA	0.316	6.14	0.057	0.455	5.3.3.3	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.17	0.680	3.70	0.09	0.81	4qimA	GO:0000122 GO:0001503 GO:0001570 GO:0001649 GO:0001701 GO:0001708 GO:0001755 GO:0001947 GO:0002052 GO:0002053 GO:0003007 GO:0003140 GO:0003323 GO:0004871 GO:0004888 GO:0004930 GO:0005113 GO:0005506 GO:0005737 GO:0005794 GO:0005886 GO:0005901 GO:0005929 GO:0007165 GO:0007166 GO:0007186 GO:0007224 GO:0007228 GO:0007275 GO:0007368 GO:0007371 GO:0007389 GO:0007417 GO:0007494 GO:0008144 GO:0008284 GO:0009055 GO:0009952 GO:0009953 GO:0010468 GO:0010628 GO:0010629 GO:0016020 GO:0016021 GO:0017147 GO:0020037 GO:0021542 GO:0021696 GO:0021794 GO:0021904 GO:0021910 GO:0021938 GO:0021953 GO:0021987 GO:0022900 GO:0030666 GO:0030857 GO:0031069 GO:0034504 GO:0035264 GO:0035567 GO:0040018 GO:0042307 GO:0042475 GO:0042597 GO:0042813 GO:0042995 GO:0043066 GO:0043231 GO:0043392 GO:0045880 GO:0045892 GO:0045893 GO:0045944 GO:0046622 GO:0046872 GO:0048143 GO:0048468 GO:0048565 GO:0048568 GO:0048589 GO:0048741 GO:0048853 GO:0048873 GO:0050679 GO:0050821 GO:0051451 GO:0051799 GO:0055114 GO:0060070 GO:0060170 GO:0060248 GO:0060413 GO:0060644 GO:0060684 GO:0061053 GO:0061113 GO:0070062 GO:0070986 GO:0071397 GO:0072001 GO:0072285 GO:0072372 GO:0090190 GO:0097542 GO:2000036 GO:2000826
1	0.12	0.585	2.36	0.07	0.63	4n4wA	GO:0000122 GO:0001503 GO:0001570 GO:0001649 GO:0001701 GO:0001708 GO:0001755 GO:0001947 GO:0002052 GO:0002053 GO:0003007 GO:0003140 GO:0003323 GO:0004871 GO:0004888 GO:0004930 GO:0005113 GO:0005506 GO:0005737 GO:0005794 GO:0005886 GO:0005901 GO:0005929 GO:0007165 GO:0007166 GO:0007186 GO:0007224 GO:0007228 GO:0007275 GO:0007368 GO:0007371 GO:0007389 GO:0007417 GO:0007494 GO:0008144 GO:0008284 GO:0009055 GO:0009952 GO:0009953 GO:0010468 GO:0010628 GO:0010629 GO:0016020 GO:0016021 GO:0017147 GO:0020037 GO:0021542 GO:0021696 GO:0021794 GO:0021904 GO:0021910 GO:0021938 GO:0021953 GO:0021987 GO:0022900 GO:0030666 GO:0030857 GO:0031069 GO:0034504 GO:0035264 GO:0035567 GO:0040018 GO:0042307 GO:0042475 GO:0042597 GO:0042813 GO:0042995 GO:0043066 GO:0043231 GO:0043392 GO:0045880 GO:0045892 GO:0045893 GO:0045944 GO:0046622 GO:0046872 GO:0048143 GO:0048468 GO:0048565 GO:0048568 GO:0048589 GO:0048741 GO:0048853 GO:0048873 GO:0050679 GO:0050821 GO:0051451 GO:0051799 GO:0060070 GO:0060170 GO:0060248 GO:0060413 GO:0060644 GO:0060684 GO:0061053 GO:0061113 GO:0070062 GO:0070986 GO:0071397 GO:0072001 GO:0072285 GO:0072372 GO:0090190 GO:0097542 GO:2000036 GO:2000826
2	0.07	0.552	3.96	0.08	0.66	4z34A	GO:0000187 GO:0001965 GO:0004871 GO:0004930 GO:0005506 GO:0005543 GO:0005737 GO:0005768 GO:0005886 GO:0005887 GO:0007165 GO:0007186 GO:0007193 GO:0007202 GO:0007204 GO:0007420 GO:0008289 GO:0008360 GO:0009055 GO:0009986 GO:0010942 GO:0010977 GO:0014003 GO:0016020 GO:0016021 GO:0020037 GO:0021549 GO:0021554 GO:0022008 GO:0022038 GO:0022900 GO:0030139 GO:0030165 GO:0030818 GO:0032060 GO:0035025 GO:0035727 GO:0042552 GO:0042597 GO:0043005 GO:0043025 GO:0043065 GO:0043123 GO:0043197 GO:0043198 GO:0043410 GO:0046872 GO:0051482 GO:0051496 GO:0055114 GO:0060326 GO:0060999 GO:0070915 GO:0071453 GO:0071673 GO:1904566
3	0.07	0.523	4.16	0.09	0.65	4ntjA	GO:0001609 GO:0001621 GO:0001973 GO:0004871 GO:0004930 GO:0005085 GO:0005506 GO:0005622 GO:0005739 GO:0005886 GO:0005887 GO:0005901 GO:0006930 GO:0007165 GO:0007186 GO:0007188 GO:0007193 GO:0007596 GO:0007599 GO:0008347 GO:0009055 GO:0009897 GO:0009925 GO:0009986 GO:0010700 GO:0016020 GO:0016021 GO:0020037 GO:0022900 GO:0030030 GO:0030168 GO:0031224 GO:0035589 GO:0042597 GO:0043270 GO:0043491 GO:0043547 GO:0045028 GO:0045596 GO:0046872 GO:0051924 GO:0055114 GO:0070527 GO:0070588 GO:0071318 GO:0071407 GO:0071805 GO:1904139
4	0.07	0.492	5.13	0.07	0.65	4pxzA	GO:0001609 GO:0001621 GO:0001973 GO:0004871 GO:0004930 GO:0005085 GO:0005506 GO:0005622 GO:0005739 GO:0005886 GO:0005887 GO:0005901 GO:0006930 GO:0007165 GO:0007186 GO:0007188 GO:0007193 GO:0007596 GO:0007599 GO:0008347 GO:0009055 GO:0009897 GO:0009925 GO:0009986 GO:0010700 GO:0016020 GO:0016021 GO:0020037 GO:0022900 GO:0030030 GO:0030168 GO:0031224 GO:0035589 GO:0042597 GO:0043270 GO:0043491 GO:0043547 GO:0045028 GO:0045596 GO:0046872 GO:0051924 GO:0055114 GO:0070527 GO:0070588 GO:0071318 GO:0071407 GO:0071805 GO:1904139
5	0.07	0.494	3.83	0.09	0.59	4eiyA	GO:0001609 GO:0001973 GO:0004871 GO:0004930 GO:0005506 GO:0005886 GO:0005887 GO:0006171 GO:0006909 GO:0006915 GO:0006954 GO:0006968 GO:0007165 GO:0007186 GO:0007188 GO:0007267 GO:0007417 GO:0007596 GO:0007600 GO:0008015 GO:0009055 GO:0010579 GO:0016020 GO:0016021 GO:0019899 GO:0020037 GO:0022900 GO:0042597 GO:0042802 GO:0044267 GO:0046872 GO:0055114
6	0.07	0.494	4.88	0.07	0.64	4s0vA	GO:0004373 GO:0004871 GO:0004930 GO:0005886 GO:0005887 GO:0007165 GO:0007186 GO:0007200 GO:0007218 GO:0007268 GO:0007631 GO:0008188 GO:0010840 GO:0016020 GO:0016021 GO:0016499 GO:0017046 GO:0022410 GO:0032870 GO:0042277 GO:0045187 GO:0051480 GO:1901652
7	0.07	0.485	4.36	0.07	0.59	3oduA	GO:0000187 GO:0001618 GO:0001666 GO:0001764 GO:0002064 GO:0002407 GO:0003779 GO:0004871 GO:0004930 GO:0004950 GO:0005737 GO:0005764 GO:0005768 GO:0005769 GO:0005770 GO:0005886 GO:0006915 GO:0006935 GO:0006954 GO:0007165 GO:0007186 GO:0007204 GO:0008038 GO:0008144 GO:0009615 GO:0009986 GO:0015026 GO:0016020 GO:0016021 GO:0016023 GO:0016032 GO:0016477 GO:0016494 GO:0019064 GO:0019722 GO:0019955 GO:0022029 GO:0030054 GO:0030260 GO:0030334 GO:0031252 GO:0031410 GO:0031625 GO:0032027 GO:0043067 GO:0043130 GO:0043217 GO:0048714 GO:0050920 GO:0051924 GO:0060048 GO:0070062 GO:0070098 GO:0071345
8	0.07	0.474	4.28	0.06	0.58	5dsgB	GO:0003796 GO:0003824 GO:0004871 GO:0004930 GO:0005085 GO:0005737 GO:0005886 GO:0005887 GO:0007165 GO:0007166 GO:0007186 GO:0007197 GO:0007207 GO:0007213 GO:0007271 GO:0008152 GO:0008283 GO:0009253 GO:0010033 GO:0014069 GO:0016020 GO:0016021 GO:0016787 GO:0016798 GO:0016907 GO:0016998 GO:0019076 GO:0019835 GO:0030054 GO:0030430 GO:0032279 GO:0040012 GO:0042383 GO:0042742 GO:0043025 GO:0043547 GO:0043679 GO:0045202 GO:0045211
9	0.07	0.484	4.19	0.07	0.59	4ib4A	GO:0001755 GO:0001819 GO:0001938 GO:0001965 GO:0002031 GO:0003007 GO:0003300 GO:0004871 GO:0004930 GO:0004993 GO:0005096 GO:0005506 GO:0005737 GO:0005886 GO:0005887 GO:0006182 GO:0006874 GO:0006939 GO:0007165 GO:0007186 GO:0007202 GO:0007205 GO:0007210 GO:0007507 GO:0007610 GO:0008144 GO:0008284 GO:0009055 GO:0010507 GO:0010513 GO:0014033 GO:0014065 GO:0014827 GO:0016020 GO:0016021 GO:0016310 GO:0019722 GO:0020037 GO:0022900 GO:0030054 GO:0030425 GO:0034220 GO:0035733 GO:0042310 GO:0042493 GO:0042597 GO:0043005 GO:0043025 GO:0043066 GO:0043123 GO:0043406 GO:0043547 GO:0043647 GO:0045202 GO:0046872 GO:0048598 GO:0050715 GO:0050795 GO:0051000 GO:0051209 GO:0051378 GO:0051781 GO:0055114 GO:0060548 GO:0070371 GO:0070374 GO:0070528 GO:0071418 GO:0071502 GO:1904015
10	0.07	0.481	4.86	0.06	0.61	3v2yA	GO:0001525 GO:0001664 GO:0001955 GO:0003245 GO:0003376 GO:0003796 GO:0003824 GO:0004871 GO:0004930 GO:0005768 GO:0005829 GO:0005886 GO:0006935 GO:0007155 GO:0007165 GO:0007186 GO:0007193 GO:0007420 GO:0008152 GO:0008284 GO:0009253 GO:0009897 GO:0016020 GO:0016021 GO:0016477 GO:0016787 GO:0016798 GO:0016998 GO:0019076 GO:0019226 GO:0019835 GO:0030032 GO:0030155 GO:0030182 GO:0030335 GO:0030430 GO:0030500 GO:0031226 GO:0031532 GO:0038036 GO:0042742 GO:0043547 GO:0045121 GO:0045124 GO:0045446 GO:0045944 GO:0046625 GO:0048661 GO:0050927 GO:0051482 GO:0051497 GO:0061384 GO:0072678
11	0.07	0.474	5.00	0.06	0.60	5dgyA	GO:0000139 GO:0001523 GO:0001750 GO:0001917 GO:0002046 GO:0003796 GO:0003824 GO:0004871 GO:0004930 GO:0005794 GO:0005886 GO:0005887 GO:0005911 GO:0006468 GO:0007165 GO:0007186 GO:0007601 GO:0007602 GO:0007603 GO:0008020 GO:0008152 GO:0009253 GO:0009416 GO:0009583 GO:0009585 GO:0009881 GO:0016020 GO:0016021 GO:0016038 GO:0016056 GO:0016787 GO:0016798 GO:0016918 GO:0016998 GO:0018298 GO:0019076 GO:0019835 GO:0022400 GO:0030430 GO:0030507 GO:0030660 GO:0030867 GO:0042622 GO:0042742 GO:0045494 GO:0046872 GO:0050896 GO:0050953 GO:0051219 GO:0060041 GO:0060170 GO:0060342 GO:0071482 GO:0097381
12	0.07	0.481	4.10	0.07	0.59	4iarA	GO:0002031 GO:0004871 GO:0004930 GO:0004993 GO:0005506 GO:0005737 GO:0005886 GO:0005887 GO:0007165 GO:0007186 GO:0007187 GO:0007198 GO:0007205 GO:0007268 GO:0007610 GO:0007631 GO:0008144 GO:0009055 GO:0014059 GO:0014063 GO:0016020 GO:0016021 GO:0020037 GO:0022900 GO:0030818 GO:0032229 GO:0035690 GO:0042220 GO:0042310 GO:0042493 GO:0042597 GO:0042756 GO:0045471 GO:0046849 GO:0046872 GO:0050795 GO:0051378 GO:0051385 GO:0051967 GO:0055114 GO:0071312 GO:0071502
13	0.07	0.478	5.19	0.05	0.61	4ej4A	GO:0000060 GO:0003796 GO:0003824 GO:0004871 GO:0004930 GO:0004985 GO:0005737 GO:0005886 GO:0005887 GO:0007165 GO:0007186 GO:0007191 GO:0007193 GO:0007200 GO:0007218 GO:0007268 GO:0008152 GO:0008344 GO:0009253 GO:0010629 GO:0016020 GO:0016021 GO:0016787 GO:0016798 GO:0016998 GO:0019076 GO:0019233 GO:0019835 GO:0030430 GO:0031226 GO:0031982 GO:0032460 GO:0032590 GO:0033138 GO:0038003 GO:0038046 GO:0042742 GO:0042755 GO:0042923 GO:0043005 GO:0043679 GO:0045121 GO:0045211 GO:0051881 GO:0051924 GO:0051930 GO:0071363 GO:0071456 GO:0097237
14	0.07	0.475	4.57	0.07	0.59	5cxvA	GO:0003056 GO:0003796 GO:0003824 GO:0004435 GO:0004871 GO:0004930 GO:0005886 GO:0005887 GO:0006464 GO:0007165 GO:0007186 GO:0007197 GO:0007205 GO:0007207 GO:0007213 GO:0007271 GO:0007274 GO:0007399 GO:0008144 GO:0008152 GO:0008283 GO:0008284 GO:0009253 GO:0014069 GO:0016020 GO:0016021 GO:0016787 GO:0016798 GO:0016907 GO:0016998 GO:0019076 GO:0019835 GO:0030054 GO:0030425 GO:0030430 GO:0032279 GO:0040012 GO:0042742 GO:0043270 GO:0043679 GO:0045202 GO:0045211 GO:0046541 GO:0050890 GO:0090316
15	0.07	0.464	4.12	0.06	0.56	4dklA	GO:0001965 GO:0002438 GO:0003796 GO:0003824 GO:0004871 GO:0004930 GO:0004979 GO:0004985 GO:0005245 GO:0005737 GO:0005829 GO:0005886 GO:0005887 GO:0005925 GO:0007165 GO:0007186 GO:0007191 GO:0007193 GO:0007194 GO:0007200 GO:0007204 GO:0007218 GO:0007268 GO:0007626 GO:0008022 GO:0008152 GO:0009253 GO:0009314 GO:0016020 GO:0016021 GO:0016787 GO:0016798 GO:0016998 GO:0019076 GO:0019233 GO:0019835 GO:0019904 GO:0030425 GO:0030430 GO:0030818 GO:0031005 GO:0031635 GO:0031681 GO:0032094 GO:0032100 GO:0032496 GO:0032590 GO:0032839 GO:0033554 GO:0038003 GO:0038047 GO:0042060 GO:0042220 GO:0042383 GO:0042742 GO:0042755 GO:0042923 GO:0043005 GO:0043204 GO:0043278 GO:0043950 GO:0043951 GO:0044849 GO:0045019 GO:0045121 GO:0045429 GO:0045471 GO:0048149 GO:0050769 GO:0051481 GO:0051930 GO:0060079 GO:0061358 GO:0070374 GO:0070588 GO:0070848 GO:0071315 GO:0098794 GO:2000310
16	0.07	0.452	4.18	0.07	0.55	2g87A	GO:0000139 GO:0001750 GO:0001917 GO:0004871 GO:0004930 GO:0005085 GO:0005794 GO:0005886 GO:0005887 GO:0005911 GO:0006468 GO:0007165 GO:0007186 GO:0007601 GO:0007602 GO:0007603 GO:0008020 GO:0009416 GO:0009583 GO:0009881 GO:0016020 GO:0016021 GO:0016038 GO:0016056 GO:0018298 GO:0022400 GO:0042622 GO:0043547 GO:0045494 GO:0046872 GO:0050896 GO:0050953 GO:0060041 GO:0060342 GO:0071482 GO:0097381
17	0.07	0.459	4.23	0.07	0.55	5dhhB	GO:0001626 GO:0001934 GO:0004871 GO:0004930 GO:0004985 GO:0005506 GO:0005886 GO:0005887 GO:0007165 GO:0007186 GO:0007193 GO:0007204 GO:0007218 GO:0007268 GO:0007600 GO:0007610 GO:0008022 GO:0009055 GO:0016020 GO:0016021 GO:0016023 GO:0019233 GO:0020037 GO:0022900 GO:0030817 GO:0030818 GO:0031410 GO:0032355 GO:0035810 GO:0038003 GO:0042597 GO:0042755 GO:0042923 GO:0043005 GO:0044849 GO:0045776 GO:0046872 GO:0051930 GO:0060454 GO:1901386 GO:1904058 GO:1904059
18	0.07	0.455	4.86	0.07	0.58	4u14A	GO:0003056 GO:0003796 GO:0003824 GO:0004871 GO:0004930 GO:0005886 GO:0005887 GO:0006939 GO:0007165 GO:0007186 GO:0007197 GO:0007207 GO:0007213 GO:0007271 GO:0007586 GO:0008144 GO:0008152 GO:0009253 GO:0016020 GO:0016021 GO:0016323 GO:0016787 GO:0016798 GO:0016907 GO:0016998 GO:0019076 GO:0019229 GO:0019835 GO:0030054 GO:0030425 GO:0030430 GO:0032279 GO:0042166 GO:0042742 GO:0043679 GO:0045202 GO:0045211 GO:0045987 GO:0046541

Consensus prediction of GO terms

Molecular Function	GO:0005102	GO:0005506	GO:0020037	GO:0004930	GO:0009055
GO-Score	0.54	0.40	0.40	0.40	0.40
Biological Processes	GO:0048747	GO:0061371	GO:0042636	GO:0051091	GO:0060242	GO:0007227	GO:0014904	GO:0010629	GO:0031647	GO:0048565	GO:0021766	GO:0014812	GO:0045596	GO:0051100	GO:0097306	GO:0030856	GO:0048639	GO:0050678	GO:0021587	GO:0030182	GO:0036315	GO:0070723	GO:0090316	GO:0042476	GO:1902692	GO:0060411	GO:0003209	GO:0021695	GO:1903507	GO:0040014	GO:0090189	GO:0001667	GO:0042306	GO:1904591	GO:0006357	GO:0014002	GO:0003283	GO:0007519	GO:0021937	GO:0021513	GO:0019827	GO:0048730	GO:0003143	GO:0009798	GO:0045893	GO:0046620	GO:0048872	GO:0009967	GO:0072093	GO:0016055	GO:0045683	GO:0003309	GO:0008589	GO:0072036	GO:0051101	GO:0045165	GO:0042981	GO:0061180	GO:0001775	GO:0043069	GO:0048368	GO:0001894	GO:2000113	GO:0007418	GO:0051797	GO:0002068	GO:0021532	GO:0048854	GO:0061213	GO:0010464	GO:0060972	GO:0048514	GO:0046824	GO:0014032	GO:0060246	GO:2000648	GO:0003337	GO:0021536	GO:1900182	GO:0050769	GO:0022900	GO:0007188
GO-Score	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.40	0.37
Cellular Component	GO:0098588	GO:1903561	GO:0044441	GO:0012505	GO:0030139	GO:0031253	GO:0030659	GO:0016021	GO:0042597	GO:0031226	GO:0005901
GO-Score	0.54	0.54	0.54	0.54	0.54	0.54	0.54	0.40	0.40	0.37	0.36

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.