I-TASSER results

Input Sequence in FASTA format

>protein (94 residues)
MSFVIAAPEALDSAATDLVVLGSTLGAATAAAAAQTTGIVAAAHDEVSAAIAALFSAHGQ
AYQAASAQAAAFHTRFIRARSRHPQQETTCRRVR

Predicted Secondary Structure

Sequence	20 40 60 80 \| \| \| \| MSFVIAAPEALDSAATDLVVLGSTLGAATAAAAAQTTGIVAAAHDEVSAAIAALFSAHGQAYQAASAQAAAFHTRFIRARSRHPQQETTCRRVR
Prediction	CCEEHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Conf.Score	9766646799999999999998899999887777765456777658999999999999999999999999999999999998788888876559
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 \| \| \| \| MSFVIAAPEALDSAATDLVVLGSTLGAATAAAAAQTTGIVAAAHDEVSAAIAALFSAHGQAYQAASAQAAAFHTRFIRARSRHPQQETTCRRVR
Prediction	6433433233133114314513332432333023333434433432013200430342043024114303411430142044344313313448
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80

                   |                   |                   |                   |

Sec.Str
Seq

CCEEHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
MSFVIAAPEALDSAATDLVVLGSTLGAATAAAAAQTTGIVAAAHDEVSAAIAALFSAHGQAYQAASAQAAAFHTRFIRARSRHPQQETTCRRVR

2g38C

0.29

0.23

0.81

1.34

MUSTER

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG-----------

2g38C

0.29

0.23

0.81

1.37

dPPAS

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG-----------

2g38C

0.29

0.23

0.81

2.79

wdPPAS

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG-----------

2g38C

0.29

0.23

0.81

1.75

wMUSTER

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG-----------

2g38C

0.29

0.23

0.81

2.51

wPPAS

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG-----------

2g38C

0.29

0.23

0.81

2.70

dPPAS2

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG-----------

2g38C

0.29

0.23

0.81

1.57

PPAS

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG-----------

2g38C

0.29

0.23

0.81

1.69

Env-PPAS

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG-----------

1wa8B

0.12

0.95

MUSTER

MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGS-----SEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNV

4i0xA

0.07

0.05

0.80

0.85

dPPAS

--------DEVGALSKFAASLADQMRAGSNSLDRDVQSLFGVWK----GSAADAYRSGWDEMQDGATKVWNALTDIASTLGSNAAAF-------

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-0.02

Estimated TM-score = 0.71±0.12

Estimated RMSD = 3.9±2.6Å

Download Model 2

C-score=-0.72

Download Model 3

C-score=-1.82

Download Model 4

C-score=-2.01

Download Model 5

C-score=-4.31

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	4nqiA	0.790	2.58	0.064	0.979
2	2g38C	0.786	0.62	0.289	0.808
3	3na7A1	0.775	2.49	0.085	0.957
4	4ckgA	0.773	2.34	0.128	0.979
5	2v0oA	0.764	2.34	0.043	0.936
6	5c1fA	0.763	2.28	0.053	0.947
7	1vw1A	0.759	2.54	0.085	0.968
8	3g67A	0.754	2.25	0.065	0.936
9	1qu7A	0.749	2.34	0.033	0.936
10	4wheA	0.748	2.44	0.044	0.957

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.22	61	3is7K	HEM	Rep, Mult	26,29,30,33,60,64,67,68,70,71
2	0.07	21	2y01B	2CV	Rep, Mult	25,26,63,66,70
3	0.05	9	4de6A	ACD	Rep, Mult	33,59,60,63,67
4	0.04	11	4jolB	III	Rep, Mult	48,51,52,54,55
5	0.03	9	3a68B	CA	Rep, Mult	18,73,76
6	0.03	7	3uoiX	HEM	Rep, Mult	19,22,23,26,71,74,75,77,78
7	0.03	9	4s1xA	III	Rep, Mult	45,48,49,51,52,55,56,59,62,63,66
8	0.03	8	1h8aB	NUC	Rep, Mult	54,57,58,60,61,62
9	0.02	6	4mbeE	III	Rep, Mult	55,58,59,62,63,65,66,69
10	0.02	6	3nmiE	PXX	Rep, Mult	37,53,56,60
11	0.01	2	2g381	III	Rep, Mult	10,11,14,17,18,20,21,24,25,27,28,31,32,35,54,62,65,73,76,80,87
12	0.01	2	2j68A	GDP	Rep, Mult	24,25,26,27,28,29
13	0.00	1	2w6dA	GDP	Rep, Mult	35,36,38,39,57
14	0.00	1	2w6dB	CPL	Rep, Mult	39,40,41,42,43,51,52,54
15	0.00	1	3feuA	MG	Rep, Mult	17,20,22
16	0.00	1	4dmbA	MG	Rep, Mult	9,17
17	0.00	1	3io6A	CA	Rep, Mult	9,12
18	0.00	1	3u24A	IMD	Rep, Mult	31,34,35

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.192	1cxzB	0.587	2.33	0.027	0.755	2.7.11.13	21
2	0.149	1wt6B	0.475	2.04	0.117	0.553	2.7.11.1	27
3	0.143	1vp7B	0.483	2.41	0.058	0.638	3.1.11.6	28
4	0.142	1joyA	0.477	2.45	0.098	0.628	2.7.13.3	18,25
5	0.136	1urfA	0.543	2.81	0.082	0.777	2.7.11.13	NA
6	0.116	2h8nA	0.491	1.47	0.036	0.543	3.5.1.98	67
7	0.112	1wu0A	0.533	2.47	0.087	0.723	3.6.3.14	NA
8	0.083	2w5jA	0.529	2.67	0.067	0.734	3.6.3.14	NA
9	0.060	1clqA	0.698	3.18	0.151	0.979	2.7.7.7	26
10	0.060	1fftA	0.614	2.57	0.066	0.808	1.10.3.-	NA
11	0.060	1jtnA	0.308	3.79	0.028	0.436	3.2.1.17	NA
12	0.060	3i9wA	0.665	2.65	0.054	0.925	2.7.13.3	31
13	0.060	2z8yD	0.623	2.61	0.054	0.798	1.2.7.4,1.2.99.2	30
14	0.060	1m56A	0.601	3.20	0.043	0.862	1.9.3.1	82
15	0.060	1wleB	0.612	3.61	0.046	0.894	6.1.1.11	36
16	0.060	2e9fB	0.634	2.99	0.146	0.872	4.3.2.1	NA
17	0.060	1jqkF	0.640	2.80	0.075	0.808	1.2.99.2	NA
18	0.060	2iw5A	0.678	2.84	0.079	0.894	1.-.-.-	NA
19	0.060	2uxwA	0.608	2.87	0.107	0.830	1.3.99.-	22
20	0.060	3g61A	0.665	2.95	0.022	0.925	3.6.3.44	39
21	0.060	1is2A	0.613	3.17	0.078	0.883	1.3.3.6	NA
22	0.060	2ohyB	0.604	3.24	0.079	0.925	5.4.3.6	72
23	0.060	1qleA	0.586	3.09	0.069	0.872	1.9.3.1	NA
24	0.060	2dq3A	0.657	2.97	0.032	0.904	6.1.1.11	NA
25	0.060	3l9oA	0.618	3.54	0.054	0.894	3.6.4.13	NA
26	0.060	1z0hB	0.312	4.87	0.011	0.617	3.4.24.69	63
27	0.060	2fonB	0.660	3.21	0.054	0.936	1.3.3.6	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.34	0.847	0.99	0.27	0.90	4kxrA	GO:0005576 GO:0009405
1	0.26	0.573	2.92	0.03	0.78	3k9aA
2	0.24	0.664	2.52	0.03	0.93	2d1lA	GO:0001701 GO:0002230 GO:0003779 GO:0003785 GO:0005102 GO:0005737 GO:0005856 GO:0005912 GO:0007009 GO:0007015 GO:0007399 GO:0007517 GO:0010960 GO:0015629 GO:0030036 GO:0030041 GO:0030282 GO:0032233 GO:0034334 GO:0042802 GO:0050680 GO:0051015 GO:0061333 GO:0071498 GO:0072001 GO:0072102 GO:0072160 GO:0098792 GO:2001013
3	0.23	0.665	2.32	0.09	0.90	4nqiD	GO:0000281 GO:0000331 GO:0001891 GO:0005885 GO:0005905 GO:0006909 GO:0007009 GO:0009992 GO:0010324 GO:0031150 GO:0035091 GO:0042803 GO:0045335 GO:0046847 GO:0071476 GO:0072583
4	0.22	0.456	1.26	0.00	0.51	2x7rC	GO:0002223 GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0019064 GO:0019082 GO:0020002 GO:0030683 GO:0033644 GO:0039654 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036 GO:0075509 GO:0075512
5	0.20	0.677	2.76	0.04	0.91	1qbzA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
6	0.17	0.565	2.75	0.03	0.80	3p30A
7	0.15	0.581	3.37	0.02	0.87	1envA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0002223 GO:0003677 GO:0003682 GO:0003700 GO:0005198 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0019064 GO:0019082 GO:0020002 GO:0030683 GO:0033644 GO:0039654 GO:0039663 GO:0042802 GO:0043565 GO:0044174 GO:0044175 GO:0045899 GO:0046718 GO:0055036 GO:0060261 GO:0075509 GO:0075512 GO:1903833
8	0.15	0.618	3.08	0.06	0.89	2ezoA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
9	0.15	0.535	2.60	0.09	0.73	3cp1A	GO:0005198 GO:0019031
10	0.13	0.712	2.91	0.07	0.96	1y2oA	GO:0001726 GO:0005737 GO:0005829 GO:0005856 GO:0005886 GO:0005913 GO:0007009 GO:0007409 GO:0008022 GO:0008093 GO:0008286 GO:0008360 GO:0009617 GO:0014069 GO:0015629 GO:0016020 GO:0016358 GO:0030141 GO:0030165 GO:0030175 GO:0030838 GO:0032956 GO:0038096 GO:0042802 GO:0042995 GO:0043005 GO:0043025 GO:0043197 GO:0048010 GO:0048167 GO:0051017 GO:0051764 GO:0061003 GO:0070062 GO:0070064 GO:0097481 GO:0098609 GO:0098641 GO:2000251
11	0.13	0.665	2.39	0.04	0.86	3wfvA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
12	0.10	0.773	2.34	0.13	0.98	4ckgA	GO:0005096 GO:0005768 GO:0006810 GO:0015031 GO:0016020 GO:0043547 GO:0046872 GO:0055038
13	0.10	0.609	2.75	0.07	0.82	4h8sC	GO:0005634 GO:0005737 GO:0005768 GO:0007049 GO:0007165 GO:0008283 GO:0010008 GO:0016020 GO:0016581 GO:0031901 GO:0070062
14	0.08	0.586	3.20	0.01	0.89	2q13A	GO:0005634 GO:0005737 GO:0005768 GO:0005829 GO:0007049 GO:0007165 GO:0008283 GO:0008286 GO:0010008 GO:0012506 GO:0016020 GO:0016581 GO:0031901 GO:0042802 GO:0043422 GO:0046324 GO:0070062 GO:0090003 GO:0097192
15	0.07	0.612	2.69	0.07	0.84	1qsdA	GO:0005737 GO:0005856 GO:0005874 GO:0007021 GO:0007023 GO:0015631 GO:0048487
16	0.06	0.352	3.50	0.03	0.48	4mk0A	GO:0000166 GO:0002026 GO:0002029 GO:0003108 GO:0004672 GO:0004674 GO:0004703 GO:0005524 GO:0005737 GO:0005829 GO:0005886 GO:0006468 GO:0007165 GO:0007186 GO:0007213 GO:0007217 GO:0007507 GO:0016020 GO:0016301 GO:0016310 GO:0016740 GO:0018105 GO:0018107 GO:0019079 GO:0031623 GO:0031694 GO:0031755 GO:0033605 GO:0045988 GO:0046718 GO:0047696 GO:0060048 GO:0072372
17	0.06	0.366	3.77	0.03	0.56	2h1yB	GO:0003824 GO:0004314 GO:0008152 GO:0016740 GO:0016746
18	0.06	0.331	3.76	0.00	0.47	2p51A	GO:0000289 GO:0003676 GO:0003723 GO:0003729 GO:0004518 GO:0004527 GO:0004535 GO:0005634 GO:0005737 GO:0005829 GO:0006351 GO:0006355 GO:0016787 GO:0030014 GO:0030015 GO:0046872 GO:0090305 GO:0090503
19	0.06	0.367	4.55	0.08	0.69	3uzsA	GO:0000166 GO:0002029 GO:0002031 GO:0003108 GO:0004672 GO:0004674 GO:0004703 GO:0005524 GO:0005737 GO:0005829 GO:0005886 GO:0006468 GO:0006886 GO:0007165 GO:0007186 GO:0007213 GO:0009966 GO:0016020 GO:0016301 GO:0016310 GO:0016740 GO:0018105 GO:0031694 GO:0031755 GO:0045988 GO:0047696 GO:0060048
20	0.06	0.332	3.05	0.03	0.44	2dn6A	GO:0003677 GO:0005509 GO:0005524 GO:0005634 GO:0005737 GO:0005829 GO:0005856 GO:0005886 GO:0005913 GO:0007204 GO:0008064 GO:0016020 GO:0016444 GO:0030027 GO:0030835 GO:0032233 GO:0032880 GO:0033633 GO:0042995 GO:0045190 GO:0051017 GO:0060754 GO:0098609 GO:0098641 GO:1902309
21	0.06	0.350	3.75	0.03	0.49	3ljuX	GO:0005096 GO:0005634 GO:0005737 GO:0005886 GO:0007166 GO:0043087 GO:0043533 GO:0043547 GO:0046872
22	0.06	0.336	2.07	0.10	0.40	4hhvA	GO:0000902 GO:0001701 GO:0003007 GO:0004672 GO:0005654 GO:0005737 GO:0005739 GO:0005783 GO:0005789 GO:0005794 GO:0005829 GO:0006468 GO:0006672 GO:0006810 GO:0006869 GO:0006936 GO:0006955 GO:0007029 GO:0007165 GO:0008283 GO:0008289 GO:0016301 GO:0016310 GO:0030148 GO:0034976 GO:0035620 GO:0035621 GO:0048471 GO:0055088 GO:0070273 GO:0070584 GO:0097001
23	0.06	0.333	3.27	0.04	0.48	2da0A	GO:0005096 GO:0005546 GO:0005547 GO:0005737 GO:0005829 GO:0005913 GO:0016020 GO:0030030 GO:0043197 GO:0043547 GO:0046872 GO:0060271 GO:0061000 GO:0098609 GO:0098641
24	0.06	0.314	2.91	0.00	0.40	1fb8A	GO:0005543 GO:0005547 GO:0005737 GO:0005829 GO:0005886 GO:0006470 GO:0007165 GO:0016020 GO:0043325
25	0.06	0.302	3.84	0.09	0.45	1v89A	GO:0005096 GO:0005829 GO:0007165 GO:0043547 GO:0051056
26	0.06	0.320	3.67	0.14	0.46	1eazA	GO:0001553 GO:0005634 GO:0005654 GO:0005737 GO:0005886 GO:0007283 GO:0008209 GO:0008210 GO:0008289 GO:0008585 GO:0009791 GO:0014065 GO:0016020 GO:0030165 GO:0031529 GO:0032587 GO:0033327 GO:0035264 GO:0043325 GO:0045184 GO:0048008 GO:0048705 GO:0050853 GO:0051898 GO:0060021 GO:0060325 GO:0070062 GO:0070301

Consensus prediction of GO terms

Molecular Function	GO:0003779	GO:0032403	GO:0046983	GO:0005543
GO-Score	0.47	0.47	0.46	0.46
Biological Processes	GO:0050678	GO:0016236	GO:0008154	GO:0051258	GO:0034332	GO:0044089	GO:0008285	GO:0001503	GO:0061333	GO:0034405	GO:0032835	GO:0061061	GO:0055065	GO:0051495	GO:0050691	GO:0072080	GO:0032231	GO:0034331	GO:0043009	GO:0072507	GO:0031214	GO:0035850	GO:0031154	GO:0030104	GO:0030031	GO:0006884	GO:0044765	GO:0055082	GO:1903047	GO:0071470	GO:0006971	GO:0061640	GO:0019049	GO:0016485	GO:0019080	GO:0050687	GO:0050690	GO:0020012	GO:0019065	GO:0044800	GO:0044650	GO:0002220	GO:0007009	GO:0009405
GO-Score	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.47	0.46	0.46	0.46	0.46	0.46	0.46	0.46	0.46	0.46	0.46	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.41	0.34
Cellular Component	GO:0070161	GO:0012505	GO:0043234	GO:0044430	GO:0030139	GO:0044459	GO:0098589	GO:0005773	GO:0044174	GO:0033644	GO:0036338	GO:0031224	GO:0005576
GO-Score	0.47	0.46	0.46	0.46	0.46	0.46	0.46	0.46	0.43	0.43	0.43	0.34	0.34

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv3650

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]