I-TASSER results

Input Sequence in FASTA format

>protein (98 residues)
MSFTAQPEMLAAAAGELRSLGATLKASNAAAAVPTTGVVPPAADEVSLLLATQFRTHAAT
YQTASAKAAVIHEQFVTTLATSASSYADTEAANAVVTG

Predicted Secondary Structure

Sequence	20 40 60 80 \| \| \| \| MSFTAQPEMLAAAAGELRSLGATLKASNAAAAVPTTGVVPPAADEVSLLLATQFRTHAATYQTASAKAAVIHEQFVTTLATSASSYADTEAANAVVTG
Prediction	CCEEHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Conf.Score	95775769999999999999999999887777775445677776788999999999999999999999999999999999988999999999987569
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 \| \| \| \| MSFTAQPEMLAAAAGELRSLGATLKASNAAAAVPTTGVVPPAADEVSLLLATQFRTHAATYQTASAKAAVIHEQFVTTLATSASSYADTEAANAVVTG
Prediction	74442334303311431441333243333302333332443344301220132024215303411440331042124203433432131123234668
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80

                   |                   |                   |                   |

Sec.Str
Seq

CCEEHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
MSFTAQPEMLAAAAGELRSLGATLKASNAAAAVPTTGVVPPAADEVSLLLATQFRTHAATYQTASAKAAVIHEQFVTTLATSASSYADTEAANAVVTG

2g38C

0.42

0.33

0.78

1.29

MUSTER

------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.42

0.33

0.78

1.29

dPPAS

------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.42

0.33

0.78

2.63

wdPPAS

------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.42

0.33

0.78

1.72

wMUSTER

------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.42

0.33

0.78

2.40

wPPAS

------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.42

0.33

0.78

2.49

dPPAS2

------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.42

0.33

0.78

1.50

PPAS

------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.42

0.33

0.78

1.69

Env-PPAS

------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

1wa8B

0.10

0.09

0.94

0.95

MUSTER

MT-QWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGS-----SEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA

3zbhA

0.17

0.15

0.92

0.85

dPPAS

----LTPEELRGVARQYNVESSNVTELIARLDQMSHTLQGIWEG----ASSEAFIQQYQELRPSFEKMAVLLNEVGQQLHNSATILEDTDQQIASQIR

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=0.02

Estimated TM-score = 0.72±0.11

Estimated RMSD = 3.9±2.6Å

Download Model 2

C-score=-2.87

Download Model 3

C-score=-5.00

Download Model 4

C-score=-5.00

Download Model 5

C-score=-5.00

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	1vw1A	0.809	1.89	0.112	0.959
2	5c21A	0.801	2.14	0.092	0.959
3	2v0oA	0.800	1.92	0.052	0.949
4	4nqiA	0.798	2.10	0.082	0.969
5	2ch7A	0.797	2.16	0.072	0.969
6	3g67A	0.796	2.03	0.063	0.949
7	4ckgA	0.783	2.23	0.153	1.000
8	3zbhA	0.780	1.71	0.169	0.908
9	4wheA	0.775	2.16	0.126	0.959
10	3na7A	0.772	2.09	0.041	0.949

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.21	94	3is7K	HEM	Rep, Mult	18,21,22,25,66,70,73,74,76,77
2	0.10	44	2e42A	NUC	Rep, Mult	47,48,51,52,54,55,56
3	0.08	35	2yjjI	OFE	Rep, Mult	25,28,62,66
4	0.07	27	1fz1A	FE	Rep, Mult	17,72,75
5	0.05	25	1gtwB	NUC	Rep, Mult	54,57,58,60,61,62,64
6	0.03	11	3wuvN	III	Rep, Mult	59,62,73,80
7	0.02	11	4eotA	NUC	Rep, Mult	54,55,59,62,63,66
8	0.01	7	2r5dC	III	Rep, Mult	76,79,80,83,87
9	0.01	4	1t8zE	12P	Rep, Mult	50,54,57,61,64,68,71
10	0.01	3	2y02A	2CV	Rep, Mult	32,35,54,58,61
11	0.01	5	4mbeE	III	Rep, Mult	58,61,62,65,66,68,69,72
12	0.01	6	1jb0B	CLA	Rep, Mult	13,17,20,68,72
13	0.00	1	1xrmA	III	Rep, Mult	76,79
14	0.00	1	3d1lB	MPR	Rep, Mult	79,97,98
15	0.00	2	1y66A	DIO	Rep, Mult	46,50

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.384	2w5jA	0.508	3.06	0.079	0.735	3.6.3.14	73
2	0.245	2h8nA	0.529	1.23	0.070	0.571	3.5.1.98	62,72
3	0.235	3e7kH	0.473	1.95	0.089	0.551	2.7.11.1	NA
4	0.216	1wt6B	0.507	1.91	0.081	0.582	2.7.11.1	19,26
5	0.166	1urfA	0.558	2.53	0.026	0.725	2.7.11.13	22
6	0.135	1cxzB	0.565	2.45	0.027	0.735	2.7.11.13	24
7	0.098	1wu0A	0.567	2.08	0.141	0.714	3.6.3.14	NA
8	0.060	1w07B	0.658	3.21	0.083	0.898	1.3.3.6	NA
9	0.060	1k7wD	0.609	2.88	0.060	0.847	4.3.2.1	NA
10	0.060	2b5uA	0.683	3.01	0.061	0.990	3.1.-.-	NA
11	0.060	1p49A	0.585	3.95	0.074	0.949	3.1.6.2	NA
12	0.060	3ffzA	0.608	3.87	0.095	0.959	3.4.24.69	NA
13	0.060	2iw5A	0.687	2.59	0.097	0.888	1.-.-.-	36
14	0.060	1y2mB	0.599	3.41	0.085	0.878	4.3.1.24	NA
15	0.060	3no9A	0.683	2.81	0.074	0.898	4.2.1.2	21
16	0.060	1j3uA	0.590	3.03	0.044	0.796	4.3.1.1	56,57
17	0.060	3g61A	0.715	2.73	0.084	0.949	3.6.3.44	25
18	0.060	2hvgA	0.579	2.56	0.080	0.775	4.3.2.2	NA
19	0.060	1dcnB	0.550	3.71	0.064	0.837	4.3.2.1	73
20	0.060	1qleC	0.588	2.55	0.056	0.755	1.9.3.1	68
21	0.060	1wleB	0.600	3.19	0.098	0.857	6.1.1.11	35,55
22	0.060	1eiyA	0.605	2.73	0.145	0.796	6.1.1.20	NA
23	0.060	2np0A	0.567	3.60	0.041	0.908	3.4.24.69	NA
24	0.060	2fonB	0.667	3.29	0.074	0.888	1.3.3.6	NA
25	0.060	2zr3B	0.621	3.25	0.052	0.878	6.1.1.11	NA
26	0.060	1qd1B	0.329	4.33	0.068	0.582	2.1.2.5,4.3.1.4	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.40	0.812	1.00	0.42	0.87	4kxrA	GO:0005576 GO:0009405
1	0.31	0.480	1.78	0.07	0.55	1dh3A	GO:0000785 GO:0000790 GO:0000975 GO:0000978 GO:0000980 GO:0001102 GO:0001190 GO:0001666 GO:0003677 GO:0003690 GO:0003700 GO:0003705 GO:0005634 GO:0005654 GO:0005667 GO:0005719 GO:0005739 GO:0005759 GO:0006351 GO:0006355 GO:0006366 GO:0006468 GO:0007179 GO:0007219 GO:0007409 GO:0007568 GO:0007595 GO:0007613 GO:0007623 GO:0008134 GO:0008361 GO:0008542 GO:0010033 GO:0010629 GO:0010944 GO:0014823 GO:0019899 GO:0021983 GO:0030154 GO:0030424 GO:0030544 GO:0030879 GO:0032916 GO:0033363 GO:0033762 GO:0034670 GO:0035035 GO:0035094 GO:0035497 GO:0035729 GO:0036120 GO:0036276 GO:0040018 GO:0042493 GO:0042752 GO:0042802 GO:0042981 GO:0043065 GO:0043565 GO:0044212 GO:0045600 GO:0045672 GO:0045893 GO:0045899 GO:0045944 GO:0046887 GO:0046889 GO:0048145 GO:0048511 GO:0050821 GO:0055025 GO:0060251 GO:0060428 GO:0060430 GO:0060509 GO:0071294 GO:0071363 GO:0071398 GO:0071560 GO:1900273 GO:1901215 GO:1902065 GO:1990090 GO:1990314 GO:1990589 GO:1990763
2	0.30	0.462	0.74	0.11	0.48	3he5A
3	0.25	0.609	2.52	0.02	0.78	3p30A
4	0.22	0.638	2.24	0.06	0.82	3wfvA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
5	0.21	0.609	2.62	0.05	0.85	5frgA	GO:0005086 GO:0005737 GO:0005802 GO:0005856 GO:0005886 GO:0005938 GO:0006897 GO:0006914 GO:0008289 GO:0016020 GO:0016023 GO:0016192 GO:0031410 GO:0043547
6	0.19	0.581	2.83	0.03	0.78	3k9aA
7	0.16	0.622	2.80	0.04	0.87	1qbzA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
8	0.16	0.604	3.16	0.03	0.87	2ezoA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
9	0.14	0.551	2.33	0.07	0.71	3cp1A	GO:0005198 GO:0019031
10	0.11	0.596	2.76	0.01	0.76	1eboF	GO:0005576 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0030683 GO:0033644 GO:0039502 GO:0039503 GO:0039587 GO:0039654 GO:0039663 GO:0046718 GO:0055036 GO:0075509 GO:0075512
11	0.10	0.468	1.44	0.12	0.52	2x7rC	GO:0002223 GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0019064 GO:0019082 GO:0020002 GO:0030683 GO:0033644 GO:0039654 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036 GO:0075509 GO:0075512
12	0.07	0.699	2.85	0.13	0.93	3cfoA	GO:0000166 GO:0003676 GO:0003677 GO:0003887 GO:0004518 GO:0004527 GO:0006260 GO:0008408 GO:0016740 GO:0016779 GO:0016787 GO:0039693 GO:0071897 GO:0090305
13	0.07	0.801	2.14	0.09	0.96	5c21A	GO:0005886 GO:0006810 GO:0008565 GO:0009306 GO:0015031 GO:0016020 GO:0016021 GO:0019835 GO:0044179
14	0.07	0.481	3.62	0.07	0.78	2v4dB	GO:0005886 GO:0006810 GO:0006855 GO:0015238 GO:0016020 GO:0031226 GO:0046677 GO:0055085
15	0.07	0.504	3.40	0.02	0.71	4ojjC	GO:0000290 GO:0000776 GO:0000932 GO:0001731 GO:0003682 GO:0003723 GO:0003729 GO:0005634 GO:0005737 GO:0006397 GO:0006417 GO:0006446 GO:0007049 GO:0007059 GO:0010494 GO:0022627 GO:0033962 GO:0045947 GO:0051301 GO:0061641 GO:1990726
16	0.07	0.480	3.54	0.06	0.76	4dk1B	GO:0005886 GO:0006810 GO:0006855 GO:0015238 GO:0016020 GO:0031226 GO:0042802 GO:0046677 GO:0055085
17	0.07	0.448	3.99	0.07	0.68	2y51A	GO:0000166 GO:0008152 GO:0016491 GO:0016620 GO:0055114
18	0.07	0.441	3.40	0.10	0.60	3vz2B	GO:0000166 GO:0008152 GO:0016491 GO:0016620 GO:0055114
19	0.06	0.404	2.58	0.06	0.53	1bshA	GO:0005524 GO:0005886 GO:0006754 GO:0006810 GO:0006811 GO:0015986 GO:0015992 GO:0016020 GO:0042777 GO:0045260 GO:0045261 GO:0046933 GO:0046961
20	0.06	0.382	3.98	0.07	0.55	2ggmA	GO:0000086 GO:0000715 GO:0000717 GO:0005509 GO:0005622 GO:0005634 GO:0005654 GO:0005737 GO:0005813 GO:0005814 GO:0005829 GO:0005856 GO:0005929 GO:0006281 GO:0006289 GO:0006294 GO:0006974 GO:0007049 GO:0007067 GO:0007099 GO:0007283 GO:0008017 GO:0016925 GO:0031683 GO:0032391 GO:0032465 GO:0032795 GO:0036064 GO:0046872 GO:0051301 GO:0070911 GO:0071942
21	0.06	0.449	2.89	0.06	0.57	1pq4B	GO:0005886 GO:0010043 GO:0030001 GO:0046872
22	0.06	0.375	4.67	0.04	0.73	1m1cA	GO:0019012 GO:0019028
23	0.06	0.340	3.69	0.06	0.55	4xydB	GO:0009055 GO:0016020 GO:0016021 GO:0016491 GO:0016966 GO:0020037 GO:0055114
24	0.06	0.314	4.13	0.03	0.53	3jz3B	GO:0000155 GO:0000160 GO:0000166 GO:0004673 GO:0005524 GO:0005622 GO:0005886 GO:0007165 GO:0016020 GO:0016021 GO:0016301 GO:0016310 GO:0016740 GO:0016772 GO:0018106 GO:0023014
25	0.06	0.294	3.80	0.05	0.44	2o7gB	GO:0001666 GO:0003677 GO:0003700 GO:0006351 GO:0006352 GO:0006355 GO:0009405 GO:0009408 GO:0009410 GO:0009415 GO:0016987
26	0.06	0.301	2.78	0.01	0.40	3nr8B	GO:0001958 GO:0002376 GO:0003779 GO:0005737 GO:0005794 GO:0005829 GO:0005856 GO:0005886 GO:0006006 GO:0006661 GO:0006897 GO:0007015 GO:0007155 GO:0008285 GO:0009791 GO:0010629 GO:0016020 GO:0016787 GO:0017124 GO:0030027 GO:0030175 GO:0032868 GO:0034485 GO:0042169 GO:0042995 GO:0043647 GO:0044255 GO:0046856 GO:0052659 GO:0097178
27	0.06	0.365	4.29	0.03	0.59	5d0uA	GO:0000166 GO:0003676 GO:0004386 GO:0005524 GO:0008026 GO:0016787
28	0.06	0.299	4.22	0.04	0.55	2k32A	GO:0016020 GO:0055085
29	0.06	0.303	4.14	0.05	0.55	4mjtA	GO:0046872

Consensus prediction of GO terms

Molecular Function	GO:0035035	GO:0001102	GO:0030544	GO:0000978	GO:0035497	GO:0003705	GO:1990763	GO:0001190	GO:0000980	GO:0042802
GO-Score	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31
Biological Processes	GO:0046718	GO:0044800	GO:0044650	GO:0009405	GO:0021983	GO:0007219	GO:0007409	GO:0060430	GO:0010944	GO:0007179	GO:0008361	GO:0060251	GO:0033363	GO:0014823	GO:0050821	GO:0040018	GO:0042752	GO:0032916	GO:0034670	GO:0071398	GO:0007595	GO:0036120	GO:1900273	GO:0001666	GO:0033762	GO:0007568	GO:0045600	GO:0046889	GO:1902065	GO:0048145	GO:0046887	GO:0008542	GO:0007613	GO:0035729	GO:1990090	GO:0035094	GO:0045899	GO:0071294	GO:1990314	GO:0055025	GO:1901215	GO:0045672	GO:0006468	GO:0036276	GO:0060509	GO:0043065
GO-Score	0.43	0.43	0.43	0.40	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31	0.31
Cellular Component	GO:0033648	GO:0036338	GO:0033655	GO:0033644	GO:0005576	GO:0031224	GO:0005759	GO:0030424	GO:1990589	GO:0005654	GO:0005719
GO-Score	0.43	0.43	0.43	0.43	0.40	0.34	0.31	0.31	0.31	0.31	0.31

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv3477

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]