I-TASSER results

Input Sequence in FASTA format

>protein (188 residues)
MTTRPATDRRKMPTGREEVAAAILQAATDLFAERGPAATSIRDIAARSKVNHGLVFRHFG
TKDQLVGAVLDHLGTKLTRLLHSEAPADIIERALDRHGRVLARALLDGYPVGQLQQRFPN
VAELLDAVRPRYDSDLGARLAVAHALALQFGWRLFAPMLRSATGIDELTGDELRLSVNDA
VARILEPH

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 180 \| \| \| \| \| \| \| \| \| MTTRPATDRRKMPTGREEVAAAILQAATDLFAERGPAATSIRDIAARSKVNHGLVFRHFGTKDQLVGAVLDHLGTKLTRLLHSEAPADIIERALDRHGRVLARALLDGYPVGQLQQRFPNVAELLDAVRPRYDSDLGARLAVAHALALQFGWRLFAPMLRSATGIDELTGDELRLSVNDAVARILEPH
Prediction	CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCC
Conf.Score	99999999998875589999999999999999989877889999999899999999888999999999999999999999875788785999999999999999867778999999779999999999999887777888888888899889999999987656666888999999999999996689
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 180 \| \| \| \| \| \| \| \| \| MTTRPATDRRKMPTGREEVAAAILQAATDLFAERGPAATSIRDIAARSKVNHGLVFRHFGTKDQLVGAVLDHLGTKLTRLLHSEAPADIIERALDRHGRVLARALLDGYPVGQLQQRFPNVAELLDAVRPRYDSDLGARLAVAHALALQFGWRLFAPMLRSATGIDELTGDELRLSVNDAVARILEPH
Prediction	86664677556456536511430150035002532154031430064171342101321541430022004312540352056444463034003200310021013432023025214403520440252135412421331211044123311231033113135144530142014004311558
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160                 180

                   |                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCC
MTTRPATDRRKMPTGREEVAAAILQAATDLFAERGPAATSIRDIAARSKVNHGLVFRHFGTKDQLVGAVLDHLGTKLTRLLHSEAPADIIERALDRHGRVLARALLDGYPVGQLQQRFPNVAELLDAVRPRYDSDLGARLAVAHALALQFGWRLFAPMLRSATGIDELTGDELRLSVNDAVARILEPH

3mnlA

0.17

0.16

0.95

1.76

MUSTER

LGS----------EAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAASAASEVDQVEKLIDSMFARAMAEPTEDQYHIARVISDVWLSNLLAWRRASATDVSKRLDLAVRLLIGDQ

3mnlA

0.17

0.16

0.95

1.41

dPPAS

----------LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAASAASEVDQVEKLIDSMFARAMATEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQ

3mnlA

0.17

0.16

0.95

1.92

wdPPAS

----------LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAASAASEVDQVEKLIDSMFARAMAGETEDQYHIARVISDVWLSNLLAWRRASATDVSKRLDLAVRLLIGDQ

3mnlA

0.18

0.16

0.94

2.10

wMUSTER

GS-----------EAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAASAASEVDQVEKLIDSMFARAMAGPTEDQYHIARVISDVWLSNLLAWRRASATDVSKRLDLAVRLLIGDQ

3mnlA

0.17

0.16

0.95

2.40

wPPAS

L----------GSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAASAASEVDQVEKLIDSMFARAMAGETEDQYHIARVISDVWLSNLLAWRRASATDVSKRLDLAVRLLIGDQ

3mnlA

0.18

0.16

0.94

1.92

dPPAS2

----------LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAASAASEVDQVEKLIDSMFARAMAEDQYHIARVISDVWLSNLLAWL-TRRASATDVSKRLDLAVRLLIGDQ

3mnlA

0.17

0.16

0.95

2.13

PPAS

LGS----------EAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAASAASEVDQVEKLIDSMFARAMAEPTEDQYHIARVISDVWLSNLLAWRRASATDVSKRLDLAVRLLIGDQ

4w97A

0.16

0.15

0.95

2.21

Env-PPAS

----------RVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEQPRFSYIEDRNKQQRKMWVDVLNQGIEEVDLVYRFIRDTTWVSVRPGGPLTAQQVGQQYLAIVLGGITKE

3bniA

0.18

0.16

0.90

1.67

MUSTER

--------------RSAERLTRILDACADLLDEVGYDALSTRAVALRADVPIGSVYRFFGNKRQMADALAQRNLERYAERVTERAGDGGWRGALDTVLDEYLAMKRTAPGFSLID-----FGRVAERLTELLSGYLGRRPDDDLRRVFLVAVETADTLVQLAFRVAPDGDEKIIEEARELLRAYLGRV

3bniA

0.18

0.16

0.90

1.37

dPPAS

--------------RSAERLTRILDACADLLDEVGYDALSTRAVALRADVPIGSVYRFFGNKRQMADALAQRNLERYAERVTERAGDGGWRGALDTVLDEYLAMKRTAPGFSLID-----FGRVAERLTELLSGYLGRRPDDDLRRVFLVAVETADTLVQLAFRVAPDGDEKIIEEARELLRAYLGRV

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-0.05

Estimated TM-score = 0.71±0.12

Estimated RMSD = 5.3±3.4Å

Download Model 2

C-score=-1.80

Download Model 3

C-score=-3.13

Download Model 4

C-score=-4.72

Download Model 5

C-score=-1.86

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	3mnlA	0.886	1.63	0.169	0.947
2	3bjbB	0.811	1.88	0.161	0.894
3	3angC	0.749	2.68	0.185	0.910
4	2id3A	0.730	2.85	0.175	0.910
5	2y2zA	0.727	3.18	0.153	0.931
6	2zb9A	0.726	2.97	0.154	0.899
7	5d1wA	0.722	3.44	0.151	0.952
8	3aqsA	0.721	2.63	0.154	0.856
9	2f07A	0.719	3.32	0.156	0.947
10	3b6aA	0.717	2.75	0.188	0.867

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.10	9	3zqlA	QNA	Rep, Mult	40,41,42,52,53,56,61,62
2	0.08	9	5cw8A	55X	Rep, Mult	28,70,73,74,101,104,105,108,111,115,132,152,155,158,162
3	0.07	8	3zqlA	QNA	Rep, Mult	17,51,53,54,57,58
4	0.05	7	3angD	DCC	Rep, Mult	73,101,115,126,129,149,152,155,156,159
5	0.04	5	3b6aD	ZCT	Rep, Mult	74,77,101,129,152,155
6	0.04	5	3angA	DCC	Rep, Mult	73,115,119,127,128,131,136,169,172,175,179,182
7	0.04	5	2uxhB	QUE	Rep, Mult	94,97,98,115,119,146,177,178,181,182,185
8	0.03	3	3aqtB	RCO	Rep, Mult	81,94,97,98,101,135,136,139,155
9	0.02	3	3g1mA	RF3	Rep, Mult	81,93,94,97,98,101,133,139,140,143,178,181,182,185
10	0.02	2	3lsrA	NUC	Rep, Mult	12,40,41,42,46,52,53,56
11	0.01	1	1bjyB	CTC	Rep, Mult	20,24,27
12	0.01	1	2np5C	NDS	Rep, Mult	45,46,48,52
13	0.01	1	2id3B	CA	Rep, Mult	43,47
14	0.01	1	2uxiA	G50	Rep, Mult	120,186
15	0.01	1	2np5C	NDS	Rep, Mult	115,116,118,122
16	0.01	1	3b6cA	SDN	Rep, Mult	68,71,72,75
17	0.01	1	2eh3A	MG	Rep, Mult	92,95
18	0.01	1	2rae0	III	Rep, Mult	90,91,144,145,146,148,149,150,152,153,156,159,160,163,173,182,183
19	0.01	1	3anpA	DCC	Rep, Mult	21,25,29,30
20	0.01	1	3fk7A	4DM	Rep, Mult	180,184

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	2zicA	0.481	4.99	0.058	0.787	3.2.1.70	NA
2	0.060	1m53A	0.480	4.63	0.048	0.750	5.4.99.12	33
3	0.060	2eqdA	0.463	5.43	0.051	0.803	3.2.1.151	NA
4	0.060	1hbmA	0.457	5.30	0.080	0.755	2.8.4.1	166
5	0.060	1pgjA	0.499	4.54	0.061	0.755	1.1.1.44	NA
6	0.060	1bf2A	0.471	5.07	0.047	0.766	3.2.1.68	NA
7	0.060	2wanA	0.465	4.96	0.058	0.723	3.2.1.41	24,39
8	0.060	2z8kC	0.391	5.41	0.047	0.675	2.3.2.2	26,56,74,122
9	0.060	2pulA	0.484	5.14	0.053	0.835	2.7.1.100	NA
10	0.060	3gbdA	0.483	4.61	0.060	0.750	5.4.99.11	NA
11	0.060	1n1hA	0.461	5.03	0.056	0.755	2.7.7.48	NA
12	0.060	2z8yD	0.482	5.10	0.055	0.782	1.2.7.4,1.2.99.2	111
13	0.060	2e0wB	0.459	4.86	0.049	0.723	2.3.2.2	54,67
14	0.060	3c46B	0.506	5.22	0.098	0.808	2.7.7.6	2
15	0.060	2p4qA	0.495	4.82	0.071	0.782	1.1.1.44	NA
16	0.060	2jkvA	0.493	4.61	0.060	0.766	1.1.1.44	NA
17	0.060	1jqkF	0.455	5.44	0.065	0.793	1.2.99.2	NA
18	0.060	2i2xA	0.517	4.49	0.074	0.787	2.1.1.90	31,68
19	0.060	1e5dA	0.458	5.28	0.046	0.745	1.-.-.-	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.42	0.886	1.63	0.17	0.95	3mnlA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0042803
1	0.40	0.740	3.05	0.15	0.94	2y31A	GO:0003677 GO:0006351 GO:0006355 GO:0045892
2	0.37	0.719	3.32	0.16	0.95	2f07A	GO:0003677 GO:0006351 GO:0006355
3	0.36	0.689	2.97	0.20	0.88	3bniA	GO:0003677 GO:0006351 GO:0006355
4	0.34	0.840	1.82	0.15	0.92	3bjbB	GO:0003677 GO:0006351 GO:0006355
5	0.33	0.653	3.70	0.10	0.90	4l62A	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355
6	0.33	0.598	4.13	0.13	0.88	2np3B	GO:0003677 GO:0006351 GO:0006355
7	0.32	0.642	3.74	0.07	0.89	3bcgA	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0008144 GO:0042493 GO:0043565 GO:0045892
8	0.32	0.658	3.88	0.14	0.94	1rktA	GO:0003677 GO:0006351 GO:0006355
9	0.30	0.656	3.80	0.08	0.89	3vibC	GO:0003677 GO:0006351 GO:0006355
10	0.29	0.714	2.95	0.19	0.89	2hxoA	GO:0003677 GO:0006351 GO:0006355 GO:0045892
11	0.29	0.717	2.73	0.17	0.87	3bqyA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677
12	0.28	0.676	3.31	0.13	0.86	4auxA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677 GO:0046872
13	0.28	0.539	4.36	0.14	0.82	2q24B	GO:0003677 GO:0006351 GO:0006355
14	0.28	0.613	3.80	0.19	0.85	3vvxA	GO:0003677 GO:0006351 GO:0006355
15	0.28	0.644	3.61	0.09	0.88	3lhqA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
16	0.28	0.616	3.83	0.10	0.88	3he0C	GO:0003677 GO:0006351 GO:0006355
17	0.27	0.658	3.45	0.11	0.89	3on2B	GO:0003677 GO:0006351 GO:0006355
18	0.26	0.640	3.84	0.05	0.89	3qkxA	GO:0003677 GO:0006351 GO:0006355
19	0.26	0.700	3.13	0.16	0.91	2hytA	GO:0003677 GO:0006351 GO:0006355
20	0.26	0.722	3.39	0.14	0.95	5d1wD	GO:0003677 GO:0006351 GO:0006355
21	0.26	0.726	2.97	0.15	0.90	2zb9A	GO:0003677 GO:0006351 GO:0006355
22	0.26	0.696	3.37	0.11	0.90	3lwjA	GO:0003677 GO:0006351 GO:0006355
23	0.24	0.642	3.54	0.14	0.84	3zqfA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677 GO:0046872
24	0.24	0.540	3.87	0.14	0.78	2qwtA	GO:0003677 GO:0006351 GO:0006355
25	0.24	0.674	3.42	0.09	0.88	3whcA	GO:0003677 GO:0005737 GO:0006351 GO:0006355 GO:0006629 GO:0006631 GO:0016042
26	0.24	0.692	3.55	0.14	0.92	2of7A	GO:0003677 GO:0006351 GO:0006355
27	0.23	0.607	4.29	0.11	0.90	3pasB	GO:0003677 GO:0006351 GO:0006355
28	0.23	0.662	3.49	0.15	0.90	3ni7A	GO:0003677 GO:0006351 GO:0006355
29	0.22	0.580	4.35	0.06	0.84	3s5rA	GO:0003677 GO:0006351 GO:0006355
30	0.22	0.666	3.26	0.12	0.89	3cjdA	GO:0003677 GO:0006351 GO:0006355
31	0.22	0.668	3.34	0.18	0.90	4jl3C	GO:0003677 GO:0006351 GO:0006355
32	0.22	0.660	3.93	0.18	0.94	4cgrA	GO:0003677 GO:0006351 GO:0006355
33	0.21	0.646	3.80	0.13	0.87	3zqgA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677 GO:0046872
34	0.21	0.570	4.26	0.10	0.85	3nnrA	GO:0003677 GO:0006351 GO:0006355
35	0.21	0.579	4.04	0.11	0.82	3ccyA	GO:0003677 GO:0006351 GO:0006355
36	0.21	0.574	4.33	0.06	0.87	3mvpA	GO:0003677 GO:0006351 GO:0006355
37	0.20	0.645	3.62	0.09	0.86	3b81A	GO:0003677 GO:0006351 GO:0006355
38	0.20	0.763	2.67	0.19	0.93	3angC	GO:0003677 GO:0006351 GO:0006355
39	0.20	0.592	3.88	0.13	0.85	3vuqC	GO:0003677 GO:0006351 GO:0006355
40	0.20	0.665	3.37	0.17	0.90	2qibA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
41	0.20	0.599	3.79	0.17	0.86	3dcfA	GO:0003677 GO:0006351 GO:0006355
42	0.20	0.626	3.90	0.06	0.88	2id6A	GO:0003677 GO:0006351 GO:0006355
43	0.20	0.665	3.32	0.17	0.88	2fq4A	GO:0003677 GO:0006351 GO:0006355
44	0.20	0.634	3.47	0.10	0.85	1z0xA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677
45	0.20	0.541	4.13	0.10	0.78	2iaiA	GO:0003677 GO:0006351 GO:0006355
46	0.19	0.647	3.70	0.15	0.90	3f0cA	GO:0003677 GO:0006351 GO:0006355
47	0.19	0.644	3.76	0.16	0.91	5f1jA	GO:0003677 GO:0006351 GO:0006355
48	0.19	0.657	3.74	0.14	0.92	3bhqA	GO:0003677 GO:0006351 GO:0006355
49	0.19	0.683	3.18	0.15	0.90	5d18A	GO:0003677 GO:0006351 GO:0006355
50	0.18	0.673	3.29	0.14	0.87	4za6A	GO:0003677
51	0.18	0.559	4.35	0.08	0.82	3colA	GO:0003677 GO:0006351 GO:0006355
52	0.17	0.676	3.54	0.14	0.91	3hggA	GO:0003677 GO:0006351 GO:0006355
53	0.17	0.613	3.98	0.09	0.89	4gclB	GO:0003677 GO:0005737 GO:0007049 GO:0009295 GO:0010974 GO:0043565 GO:0043590 GO:0051301 GO:0051302
54	0.16	0.573	4.12	0.08	0.82	4me9A	GO:0003677 GO:0006351 GO:0006355
55	0.16	0.741	2.85	0.16	0.91	3aqtB	GO:0003677 GO:0006351 GO:0006355
56	0.15	0.558	4.39	0.14	0.86	2oerB	GO:0003677 GO:0006351 GO:0006355
57	0.15	0.577	4.71	0.12	0.88	4jykA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0045892 GO:0045893
58	0.15	0.571	4.05	0.14	0.81	3cdlB	GO:0003677 GO:0006351 GO:0006355
59	0.15	0.735	2.80	0.18	0.91	2id3A	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0046872
60	0.15	0.600	3.55	0.15	0.78	3fiwA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677
61	0.15	0.609	3.99	0.11	0.88	2rasB	GO:0003677 GO:0006351 GO:0006355
62	0.13	0.606	4.27	0.17	0.92	2oi8A	GO:0003677 GO:0006351 GO:0006355
63	0.13	0.568	4.04	0.13	0.85	2o7tA	GO:0003677 GO:0006351 GO:0006355
64	0.12	0.707	3.04	0.17	0.90	2zcxA	GO:0003677 GO:0006351 GO:0006355
65	0.12	0.705	3.39	0.17	0.93	3c07A	GO:0003677 GO:0006351 GO:0006355
66	0.11	0.651	3.49	0.12	0.86	2raeA	GO:0003677 GO:0006351 GO:0006355
67	0.11	0.702	3.29	0.13	0.88	2vprA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677 GO:0046872
68	0.10	0.531	4.29	0.12	0.80	2pz9A	GO:0003677 GO:0003700 GO:0006351 GO:0006355
69	0.09	0.648	3.47	0.09	0.85	3frqA	GO:0003677 GO:0006351 GO:0006355 GO:0016740
70	0.08	0.610	3.77	0.08	0.86	3knwA	GO:0003677 GO:0006351 GO:0006355
71	0.08	0.647	3.63	0.13	0.89	3dpjA	GO:0003677 GO:0006351 GO:0006355
72	0.07	0.641	3.59	0.16	0.87	3p9tA	GO:0003677 GO:0006351 GO:0006355
73	0.07	0.553	4.06	0.17	0.81	2rekB	GO:0003677 GO:0006351 GO:0006355
74	0.07	0.630	3.89	0.06	0.89	3eupA	GO:0003677 GO:0006351 GO:0006355
75	0.07	0.544	4.63	0.12	0.86	3rh2A	GO:0003677 GO:0006351 GO:0006355

Consensus prediction of GO terms

Molecular Function	GO:0042803	GO:0003700	GO:0000976
GO-Score	0.42	0.42	0.42
Biological Processes	GO:0045892
GO-Score	0.40
Cellular Component	GO:0005829
GO-Score	0.42

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv3405c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]