I-TASSER results

Input Sequence in FASTA format

>protein (193 residues)
MALKHSEASGTASTKIVIAGGFGSGKTTFVGAVSEIMPLRTEAMVTDASAGVDMLEATPD
KRSTTVAMDFGRITLGEDLVLYLFGTPGQRRFWFMWDDLVRGAIGAIVLVDCRRLQDSFA
AVDFFEHRNLPFLIAINEFDSAPRYPVSAVRDALTLPAHIPVINVDARNRRSATDALIAV
SEYALATLSPAGG

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 180 \| \| \| \| \| \| \| \| \| MALKHSEASGTASTKIVIAGGFGSGKTTFVGAVSEIMPLRTEAMVTDASAGVDMLEATPDKRSTTVAMDFGRITLGEDLVLYLFGTPGQRRFWFMWDDLVRGAIGAIVLVDCRRLQDSFAAVDFFEHRNLPFLIAINEFDSAPRYPVSAVRDALTLPAHIPVINVDARNRRSATDALIAVSEYALATLSPAGG
Prediction	CCCCCCCCCCCCCEEEEEHCCCCCCHHHHHHHHHHCCCCCCCCCCEEHCCCEEHCCCCCCCCCEEEEEEEEEEEHCCCEEEEEHCCCCHHHHHHHHHHHHHCCCEEEEEEHCCCCHHHHHHHHHHHHHCCCEEEEEEHCCCCCCCCHHHHHHHHCCCCCCCEEEEHCCCCCCHHHHHHHHHHHHHHHHCCCCC
Conf.Score	9866688888865799999699977577899998688755754444545765655666666665688877899977998999977987588999999999769789999969996788999999999899899999855899899999999998689998589987799988999999999999998555799
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 180 \| \| \| \| \| \| \| \| \| MALKHSEASGTASTKIVIAGGFGSGKTTFVGAVSEIMPLRTEAMVTDASAGVDMLEATPDKRSTTVAMDFGRITLGEDLVLYLFGTPGQRRFWFMWDDLVRGAIGAIVLVDCRRLQDSFAAVDFFEHRNLPFLIAINEFDSAPRYPVSAVRDALTLPAHIPVINVDARNRRSATDALIAVSEYALATLSPAGG
Prediction	7545437553523000000123402201002204734335344323433331332444444421100112130415761301011121042034004300410100000000232740350042047460000000010136752416302610735560000001044473034002200420154267688
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160                 180

                   |                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCCCCCCCCEEEEEHCCCCCCHHHHHHHHHHCCCCCCCCCCEEHCCCEEHCCCCCCCCCEEEEEEEEEEEHCCCEEEEEHCCCCHHHHHHHHHHHHHCCCEEEEEEHCCCCHHHHHHHHHHHHHCCCEEEEEEHCCCCCCCCHHHHHHHHCCCCCCCEEEEHCCCCCCHHHHHHHHHHHHHHHHCCCCC
MALKHSEASGTASTKIVIAGGFGSGKTTFVGAVSEIMPLRTEAMVTDASAGVDMLEATPDKRSTTVAMDFGRITLGEDLVLYLFGTPGQRRFWFMWDDLVRGAIGAIVLVDCRRLQDSFAAVDFFEHRNLPFLIAINEFDSAPRYPVSAVRDALTLPAHIPVINVDARNRRSATDALIAVSEYALATLSPAGG

3t12A

0.23

0.20

0.85

2.09

MUSTER

-----------INFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLAT----------EDERTLFFDFLPLDI--KTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPLRANAESMRNMREN-VPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARV-----

3t12A

0.22

0.19

0.85

2.57

dPPAS

-----------INFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLAT----------EDERTLFFDFLPLDIKT--RFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPAESMRNMRENLAEYGVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARV-----

2lkcA

0.19

0.16

0.87

2.94

wdPPAS

-----GSHMVERPPVVTIMGHVDHGKTTLLDAIRHSKVTEQEAGGITQHIGAY------------------QVTV-NDKKITFLDTPGHEAFTTMRARGAQVTDIVILVVAADDMPQTVEAINHAKAANVPIIVAINKMDKPEA-NPDRVMQELMWGGDTIFCKLSAKTKEGLDHLLEMILLVSEMELKANP-

3t12A

0.23

0.20

0.84

2.50

wMUSTER

-------------FKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLAT----------EDERTLFFDFLPLDI--KTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPLRANAESMRNMREN-VPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARV-----

2lkcA

0.19

0.16

0.87

2.92

wPPAS

-----GSHMVERPPVVTIMGHVDHGKTTLLDAIRHSKVTEQEAGGITQHIGAY-----------QVTVN--------DKKITFLDTPGHEAFTTMRARGAQVTDIVILVVAADDMPQTVEAINHAKAANVPIIVAINKMDKPEA-NPDRVMQELMWGGDTIFCKLSAKTKEGLDHLLEMILLVSEMELKANP-

3t12A

0.22

0.19

0.85

4.62

dPPAS2

-----------INFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLAT----------EDERTLFFDFLPLDIKT--RFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPAESMRNMRENLAEYGVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARV-----

3t12A

0.23

0.20

0.85

2.56

PPAS

-----------INFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLAT----------EDERTLFFDFLPLDI--KTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPLRANAESMRNMREN-VPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARV-----

2lkcA

0.19

0.16

0.87

2.88

Env-PPAS

-----GSHMVERPPVVTIMGHVDHGKTTLLDAIRHSKVTEQEAGGITQHIGAY-----------QVTVN--------DKKITFLDTPGHEAFTTMRARGAQVTDIVILVVAADDMPQTVEAINHAKAANVPIIVAINKMDKPEA-NPDRVMQELMWGGDTIFCKLSAKTKEGLDHLLEMILLVSEMELKANP-

2ew1A

0.20

0.17

0.83

1.71

MUSTER

--------DYDFLFKIVLIGNAGVGKTCLVRRFTQGLF--------------------PPGQGATIGVDFMIKTVEEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCLPEWLREIEQYASNKVITVLVGNKIDLAERREVQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEAR----

4b3xA2

0.17

0.15

0.84

2.18

dPPAS

--------LPRRPPVVVIMGHVDHGKTTLLDYLRKSRIAEKEGGGITQHVGAFEVKTP-------------------QGTVVFIDTPGHEAFTTIRQRGAKVADIAVIVIAADDMPQTEEAIAHAKAAGAKLIFAINKIDLPQA-DPEKVKRQLMYGGDAIVIPISAKTGQGVQDLLEMILLLAELEDYR---

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=0.18

Estimated TM-score = 0.74±0.11

Estimated RMSD = 4.9±3.2Å

Download Model 2

C-score=-1.86

Download Model 3

C-score=-2.97

Download Model 4

C-score=-3.58

Download Model 5

C-score=-2.28

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	3t12A	0.783	1.82	0.236	0.855
2	3j38z	0.759	2.81	0.120	0.912
3	3dofA	0.752	2.39	0.165	0.860
4	1azsC	0.748	2.66	0.132	0.891
5	5c2kA1	0.748	2.05	0.161	0.834
6	5ganC	0.747	3.04	0.092	0.902
7	2f9mA	0.745	2.26	0.165	0.839
8	3bc1A	0.744	2.08	0.190	0.834
9	2rgnA	0.743	2.80	0.147	0.891
10	2wkpA	0.741	2.20	0.126	0.834

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.79	646	2fg5A	GNP	Rep, Mult	22,23,24,25,26,27,28,58,59,60,64,65,88,137,138,140,141,166,167,168
2	0.01	5	1uptA	MG	Rep, Mult	27,65
3	0.00	1	3t1oA	MG	Rep, Mult	43,44,68,69
4	0.00	1	3rslA	RSF	Rep, Mult	33,73,75,170,178
5	0.00	1	3hytC	MG	Rep, Mult	26,27
6	0.00	1	2bcj3	III	Rep, Mult	90,93,94,96,97,98,100,117,121,123,124,125,127,128
7	0.00	1	5c2kA	AF3	Rep, Mult	22,23,26,64,65,88,89
8	0.00	3	4dsnA	MG	Rep, Mult	20,87,88,121
9	0.00	2	3t1oA	MG	Rep, Mult	111,112,113,114,115,118,145
10	0.00	2	4js0A	III	Rep, Mult	13,14,15,27,31,33,66,68,69,70,71,72,73,74,75,76,80,82,84,95,98,99,174,178,181,182
11	0.00	1	1g16C	CO	Rep, Mult	35,170,174
12	0.00	3	2msdB	GNP	Rep, Mult	23,25,26,27,28,58,59,60,61,62,63,64,65,137,138,166,167,168
13	0.00	1	3t1oA	MG	Rep, Mult	126

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.526	2bmeA	0.753	2.06	0.182	0.839	3.6.5.2	23,89
2	0.481	2f9mA	0.745	2.26	0.165	0.839	3.6.5.2	23,89
3	0.332	3bc1A	0.744	2.08	0.190	0.834	3.6.5.2	23
4	0.146	1uqrK	0.522	4.06	0.088	0.725	4.2.1.10	NA
5	0.146	3lwzA	0.515	3.14	0.141	0.653	4.2.1.10	NA
6	0.122	3bfkB	0.735	2.27	0.153	0.834	3.6.5.2	23,89
7	0.089	2r25B	0.470	3.49	0.089	0.617	2.7.13.3	117
8	0.067	1uqrD	0.526	4.02	0.087	0.725	4.2.1.10	144
9	0.067	1cb7A	0.497	3.49	0.054	0.663	5.4.99.1	21,103
10	0.066	1d0iH	0.524	3.67	0.086	0.720	4.2.1.10	NA
11	0.066	1b1aA	0.484	3.29	0.023	0.632	5.4.99.1	NA
12	0.066	1y80A	0.467	3.09	0.078	0.596	2.1.1.13	NA
13	0.066	1bdjA	0.474	3.36	0.082	0.632	2.7.13.3	117,131
14	0.066	1gqoB	0.498	3.57	0.085	0.674	4.2.1.10	NA
15	0.066	1h0rA	0.491	3.69	0.130	0.674	4.2.1.10	144
16	0.066	1be1A	0.472	3.71	0.071	0.648	5.4.99.1	125
17	0.066	2uygA	0.481	3.74	0.079	0.658	4.2.1.10	144
18	0.066	2uygL	0.481	3.73	0.079	0.658	4.2.1.10	NA
19	0.060	2j3eA	0.648	3.54	0.124	0.850	3.6.5.-	NA
20	0.060	1aa9A	0.695	2.63	0.199	0.834	3.6.5.-	89
21	0.060	1xzpA	0.602	3.86	0.107	0.808	3.6.5.-	129
22	0.060	1cp2A	0.621	4.07	0.126	0.845	1.18.6.1	26
23	0.060	1eg7A	0.645	4.26	0.076	0.896	6.3.4.3	26
24	0.060	1f60A	0.659	3.79	0.139	0.871	3.6.5.3	NA
25	0.060	2rdo7	0.678	3.13	0.160	0.829	3.6.5.3	NA
26	0.060	2atxA	0.706	2.22	0.147	0.808	3.6.5.2	89
27	0.060	1ob2A	0.735	3.03	0.137	0.886	3.6.1.48	NA
28	0.060	2elfA	0.649	2.74	0.112	0.782	3.6.1.48	25,27
29	0.060	1e0sA	0.653	2.61	0.138	0.767	3.6.1.47	89
30	0.060	1b23P	0.739	3.01	0.137	0.891	3.6.5.3	NA
31	0.060	1cp2B	0.618	3.95	0.126	0.834	1.18.6.1	88,119,126
32	0.060	2v40A	0.557	4.35	0.138	0.814	6.3.4.4	NA
33	0.060	1m2oB	0.683	2.01	0.215	0.772	3.6.5.-	NA
34	0.060	1d2eA	0.706	3.19	0.142	0.876	3.6.5.3	NA
35	0.060	1vcmA	0.587	3.83	0.079	0.814	6.3.4.2	NA
36	0.060	2ywfA	0.679	2.75	0.179	0.808	3.6.5.-	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.35	0.754	2.38	0.16	0.86	3doeA	GO:0000166 GO:0003924 GO:0005095 GO:0005525 GO:0005622 GO:0005634 GO:0005737 GO:0005739 GO:0005758 GO:0005759 GO:0005813 GO:0005815 GO:0005829 GO:0005856 GO:0007021 GO:0007049 GO:0007264 GO:0010811 GO:0016328 GO:0031113 GO:0031116 GO:0034260 GO:0050796 GO:0051297 GO:0051457 GO:0070062 GO:0070830 GO:0072372
1	0.34	0.769	2.51	0.21	0.88	3t1tA	GO:0005525 GO:0046872
2	0.13	0.683	2.20	0.16	0.77	3cpjB	GO:0000139 GO:0000166 GO:0003924 GO:0005525 GO:0005768 GO:0005794 GO:0005802 GO:0005829 GO:0006810 GO:0006887 GO:0006914 GO:0007264 GO:0015031 GO:0016020 GO:0016192 GO:0034498 GO:0055037
3	0.13	0.759	2.81	0.12	0.91	4v6wAz	GO:0000022 GO:0000166 GO:0003746 GO:0003924 GO:0005525 GO:0005737 GO:0005811 GO:0005829 GO:0005875 GO:0006412 GO:0006414 GO:0007052
4	0.13	0.725	2.79	0.16	0.86	4zu9A	GO:0003723 GO:0003924 GO:0005525 GO:0005622 GO:0005737 GO:0006412 GO:0006790
5	0.13	0.728	3.43	0.14	0.90	3jcrB	GO:0000166 GO:0000398 GO:0003924 GO:0005525 GO:0005634 GO:0005654 GO:0005681 GO:0005737 GO:0006397 GO:0006412 GO:0008380 GO:0015030 GO:0016020 GO:0016607 GO:0031012 GO:0035690 GO:0042220 GO:0044822 GO:0071013
6	0.13	0.749	3.03	0.09	0.90	5gamC	GO:0000166 GO:0000244 GO:0000349 GO:0000388 GO:0000398 GO:0003924 GO:0005525 GO:0005634 GO:0005682 GO:0006397 GO:0006412 GO:0008380 GO:0030623 GO:0042256 GO:0046540
7	0.12	0.719	3.26	0.18	0.88	2dy1A	GO:0000166 GO:0003746 GO:0003924 GO:0005525 GO:0006414
8	0.12	0.682	2.02	0.21	0.77	4bziB	GO:0000139 GO:0000166 GO:0000266 GO:0003400 GO:0003924 GO:0005525 GO:0005622 GO:0005739 GO:0005783 GO:0005789 GO:0005794 GO:0006810 GO:0006886 GO:0007006 GO:0012507 GO:0015031 GO:0016020 GO:0016050 GO:0016192 GO:0016787 GO:0030127 GO:0031410 GO:0044233 GO:0044802 GO:0070971
9	0.12	0.682	1.96	0.25	0.76	2p5sB	GO:0000166 GO:0005509 GO:0005525 GO:0005737 GO:0007264 GO:0046872 GO:0048471
10	0.12	0.734	2.98	0.15	0.88	4v85AW	GO:0000166 GO:0003924 GO:0005525 GO:0005737 GO:0005829 GO:0006412 GO:0006415 GO:0006449 GO:0016149 GO:0016150 GO:0019003
11	0.12	0.732	2.88	0.13	0.88	3ep2X	GO:0000166 GO:0003746 GO:0003924 GO:0005525 GO:0005622 GO:0005737 GO:0006412 GO:0006414 GO:0016787
12	0.12	0.701	2.79	0.15	0.83	3tw8D	GO:0000139 GO:0000166 GO:0000910 GO:0003924 GO:0005525 GO:0005546 GO:0005739 GO:0005768 GO:0005789 GO:0005886 GO:0005905 GO:0006810 GO:0006888 GO:0007264 GO:0008104 GO:0010008 GO:0015031 GO:0016020 GO:0016197 GO:0019003 GO:0019882 GO:0030136 GO:0031175 GO:0031253 GO:0031410 GO:0032456 GO:0036010 GO:0042470 GO:0045171 GO:0045334 GO:0048227 GO:0070062 GO:1990090
13	0.12	0.729	2.60	0.17	0.85	3wxmA	GO:0000166 GO:0003746 GO:0003924 GO:0005525 GO:0005737 GO:0006412 GO:0006414
14	0.12	0.739	3.01	0.14	0.89	1b23P	GO:0000166 GO:0003746 GO:0003924 GO:0005525 GO:0005622 GO:0005737 GO:0006412 GO:0006414
15	0.12	0.722	2.81	0.19	0.85	4v9hAY	GO:0000166 GO:0003746 GO:0003924 GO:0005525 GO:0005622 GO:0005737 GO:0006412 GO:0006414
16	0.12	0.687	2.24	0.13	0.79	3lrpA	GO:0000166 GO:0005525 GO:0005622 GO:0005794 GO:0006471 GO:0006810 GO:0006886 GO:0007264 GO:0015031 GO:0016192 GO:0020020
17	0.12	0.705	2.28	0.15	0.80	2fv8A	GO:0000166 GO:0000910 GO:0001525 GO:0003924 GO:0005525 GO:0005634 GO:0005768 GO:0005769 GO:0005770 GO:0005829 GO:0005886 GO:0005925 GO:0006810 GO:0006886 GO:0006915 GO:0007155 GO:0007264 GO:0007266 GO:0007275 GO:0008333 GO:0010008 GO:0010595 GO:0015031 GO:0016020 GO:0019003 GO:0030154 GO:0030168 GO:0030334 GO:0030336 GO:0031902 GO:0032154 GO:0043065 GO:0045766 GO:0045786 GO:0051056 GO:0061154 GO:0070062 GO:0070301 GO:0071479
18	0.12	0.732	3.31	0.17	0.90	5j8bz	GO:0000166 GO:0003723 GO:0003735 GO:0003746 GO:0003924 GO:0005525 GO:0005622 GO:0005840 GO:0005886 GO:0006412 GO:0006414 GO:0016020 GO:0016787 GO:0019843 GO:0030529 GO:0043022 GO:0045727
19	0.12	0.706	2.44	0.15	0.82	3j81k	GO:0000049 GO:0000166 GO:0001731 GO:0003743 GO:0003924 GO:0005525 GO:0005850 GO:0006412 GO:0006413 GO:0016282 GO:0031369 GO:0033290 GO:0043614 GO:0045903
20	0.12	0.646	2.40	0.13	0.75	4y0vA	GO:0000166 GO:0005525 GO:0005622 GO:0007264
21	0.12	0.733	2.17	0.17	0.83	5di3B	GO:0000166 GO:0005525 GO:0005622 GO:0005886 GO:0005929 GO:0007264 GO:0016020 GO:0042995 GO:0060170
22	0.12	0.726	3.02	0.11	0.88	3j5yB	GO:0000082 GO:0000166 GO:0000184 GO:0002184 GO:0003747 GO:0003924 GO:0005525 GO:0005622 GO:0005829 GO:0006412 GO:0006479 GO:0018444 GO:0044822
23	0.12	0.714	2.35	0.20	0.82	3cphA	GO:0000131 GO:0000139 GO:0000166 GO:0003924 GO:0005525 GO:0005737 GO:0005789 GO:0005886 GO:0006810 GO:0006887 GO:0006888 GO:0006893 GO:0006906 GO:0006914 GO:0007107 GO:0007264 GO:0015031 GO:0016020 GO:0030133 GO:0030658 GO:0031321 GO:0031410 GO:0031982 GO:0043332
24	0.11	0.712	2.65	0.15	0.84	3jcjf	GO:0000166 GO:0003743 GO:0003924 GO:0005525 GO:0005622 GO:0005737 GO:0005829 GO:0006412 GO:0006413 GO:0016020 GO:0043024 GO:0097216
25	0.11	0.704	3.29	0.17	0.88	3vr1A	GO:0000166 GO:0003924 GO:0005525 GO:0005737 GO:0006412 GO:0006415 GO:0006449 GO:0016149
26	0.11	0.728	3.43	0.12	0.90	3jb9B	GO:0000166 GO:0000244 GO:0000974 GO:0003924 GO:0005525 GO:0005634 GO:0005681 GO:0005682 GO:0005737 GO:0005829 GO:0006397 GO:0006412 GO:0008380 GO:0045292 GO:0046540 GO:1902802
27	0.11	0.699	2.80	0.17	0.83	2mscB	GO:0000166 GO:0005525 GO:0005622 GO:0007165 GO:0007264 GO:0016020 GO:0046872
28	0.11	0.675	2.72	0.15	0.81	2q3fA	GO:0000166 GO:0003924 GO:0005525 GO:0005634 GO:0005737 GO:0005764 GO:0005829 GO:0007050 GO:0009267 GO:0010506 GO:0016236 GO:0032008 GO:0034448 GO:0034613 GO:0046982 GO:0071230 GO:1990131
29	0.11	0.645	2.70	0.17	0.76	2b6hA	GO:0000166 GO:0003924 GO:0005525 GO:0005622 GO:0005737 GO:0005794 GO:0005886 GO:0006810 GO:0006890 GO:0007264 GO:0015031 GO:0016020 GO:0016192 GO:0048471 GO:0070062
30	0.11	0.672	2.51	0.13	0.79	1hurA	GO:0000139 GO:0000166 GO:0000287 GO:0002090 GO:0003924 GO:0005057 GO:0005525 GO:0005622 GO:0005737 GO:0005770 GO:0005778 GO:0005794 GO:0005802 GO:0005829 GO:0005886 GO:0005925 GO:0006661 GO:0006810 GO:0006878 GO:0006892 GO:0007015 GO:0007264 GO:0012505 GO:0014069 GO:0015031 GO:0016020 GO:0016192 GO:0019003 GO:0019886 GO:0030017 GO:0030054 GO:0030137 GO:0031252 GO:0034315 GO:0034379 GO:0043005 GO:0043085 GO:0044822 GO:0045202 GO:0045211 GO:0045807 GO:0045956 GO:0048471 GO:0050690 GO:0050714 GO:0055108 GO:0060292 GO:0060999 GO:0070062 GO:0070142 GO:0097061 GO:0097212 GO:1902307 GO:1902824 GO:1902953 GO:1903725 GO:1990583
31	0.11	0.663	2.48	0.14	0.77	1z6xA	GO:0000166 GO:0003924 GO:0005086 GO:0005154 GO:0005525 GO:0005622 GO:0005737 GO:0005794 GO:0005829 GO:0005886 GO:0006471 GO:0006810 GO:0006888 GO:0006890 GO:0007173 GO:0007264 GO:0007420 GO:0007612 GO:0015031 GO:0016020 GO:0016192 GO:0016477 GO:0031012 GO:0031584 GO:0032587 GO:0043066 GO:0043197 GO:0043547 GO:0045176 GO:0045197 GO:0045944 GO:0048678 GO:0060996 GO:0061512 GO:0070062 GO:2000377
32	0.10	0.660	3.26	0.17	0.82	2lkcA	GO:0000166 GO:0003743 GO:0003924 GO:0005525 GO:0005622 GO:0005737 GO:0006412 GO:0006413
33	0.10	0.697	2.57	0.17	0.81	2hxsA	GO:0000166 GO:0003924 GO:0005525 GO:0005737 GO:0005856 GO:0005886 GO:0007264 GO:0016020 GO:0019003 GO:0035253 GO:0036064 GO:0042995 GO:1901998
34	0.10	0.647	2.22	0.18	0.75	1f6bB	GO:0000166 GO:0005525 GO:0005622 GO:0005783 GO:0005789 GO:0005794 GO:0006810 GO:0006886 GO:0015031 GO:0016020 GO:0016192 GO:0032580 GO:0046872
35	0.09	0.652	2.40	0.13	0.76	3aq4A	GO:0000166 GO:0005525 GO:0005622 GO:0005768 GO:0005794 GO:0005829 GO:0006810 GO:0007264 GO:0015031 GO:0016004 GO:0016192 GO:0043085
36	0.09	0.591	2.17	0.20	0.68	2gaoA	GO:0000166 GO:0005525 GO:0005622 GO:0005783 GO:0005794 GO:0006810 GO:0006886 GO:0015031 GO:0016192 GO:0070062
37	0.08	0.636	2.95	0.14	0.79	2k5uA	GO:0000166 GO:0003924 GO:0005525 GO:0005622 GO:0005794 GO:0006810 GO:0006888 GO:0006893 GO:0007264 GO:0015031 GO:0016192 GO:0016236
38	0.08	0.628	2.68	0.14	0.76	4ileA	GO:0000166 GO:0003924 GO:0005525 GO:0005622 GO:0005737 GO:0005764 GO:0005765 GO:0005768 GO:0007049 GO:0007059 GO:0007067 GO:0007264 GO:0016020 GO:0030496 GO:0031902 GO:0043014 GO:0048487 GO:0051233 GO:0051301 GO:0070062
39	0.07	0.651	2.90	0.16	0.78	4djtB	GO:0000166 GO:0005525 GO:0005634 GO:0006810 GO:0007264 GO:0015031
40	0.07	0.696	3.39	0.18	0.86	5ck3D	GO:0016020 GO:0016021
41	0.07	0.611	2.97	0.19	0.74	5ck5A	GO:0016020 GO:0016021

Consensus prediction of GO terms

Molecular Function	GO:0005525	GO:0003924	GO:0005095	GO:0046872
GO-Score	0.72	0.57	0.35	0.34
Biological Processes	GO:0044267	GO:0010467	GO:0043043	GO:0034645	GO:0007264	GO:0051297	GO:0007021	GO:0031116	GO:0050796	GO:0070830	GO:0034260	GO:0007049	GO:0010811	GO:0051457
GO-Score	0.49	0.49	0.49	0.49	0.43	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35
Cellular Component	GO:0005829	GO:0072372	GO:0005758	GO:0005813	GO:0070062	GO:0005634	GO:0005759	GO:0016328
GO-Score	0.51	0.35	0.35	0.35	0.35	0.35	0.35	0.35

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv3362c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]