I-TASSER results

Input Sequence in FASTA format

>protein (97 residues)
MTVRAVFRRTVGAQWPILLVGSIFAVGFVLAGANFWRRGALLIGIGVGVAAVLRLVLSEE
RAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG

Predicted Secondary Structure

Sequence	20 40 60 80 \| \| \| \| MTVRAVFRRTVGAQWPILLVGSIFAVGFVLAGANFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG
Prediction	CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHCCHHHHHHHHHHHHHHHHHHHHCCCCCCC
Conf.Score	9854567889999999999999999999999997677889999999999999999879877568999575468999999999999999865788999
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 \| \| \| \| MTVRAVFRRTVGAQWPILLVGSIFAVGFVLAGANFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG
Prediction	7434443343033312211123333312331224333310221133333223011003553010000343311123133323332330331334468
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80

                   |                   |                   |                   |

Sec.Str
Seq

CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHCCHHHHHHHHHHHHHHHHHHHHCCCCCCC
MTVRAVFRRTVGAQWPILLVGSIFAVGFVLAGANFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG

5ezmA3

0.13

0.12

0.92

1.09

MUSTER

--SPRSWGKQLIGMAIVAACGLLASPVVATLNNSFYRAYAVWVAVAFVVMLLGIAV-----ARLLLRRGVLPSVAVYAMGMYLGFTVALL-ETVGAS

5ezmA3

0.14

0.12

0.90

1.15

wMUSTER

---PRSWGKQLIGMAIVAACGLLASPVVATL-NSFYRAYAVWVAVAFVVMLLGIAV-----ARLLLRRGVLPSVAVYAMGMYLGFTVALL-ETVGAS

5ezmA3

0.14

0.12

0.91

1.19

wPPAS

-S-PRSWGKQLIGMAIVAACGLLASPVVATL-NSFYRAYAVWVAVAFVVMLLGIAV-----ARLLLRRGVLPSVAVYAMGMYLGFTVALL-ETVGAS

5ezmA3

0.14

0.12

0.87

1.10

dPPAS2

--SPRSWGKQLIGMAIVAACGLLASPVVATLNNSFYRAYAVWVAVAFVVMLLGIAV-----ARLLLRRGVLPSVAVYAMGMYLGFTVALL------G

5ezmA3

0.13

0.12

0.92

1.19

PPAS

--SPRSWGKQLIGMAIVAACGLLASPVVATLNNSFYRAYAVWVAVAFVVMLLGIAV-----ARLLLRRGVLPSVAVYAMGMYLGFTVALL-ETVGRP

2vpyC2

0.15

0.14

0.99

0.86

MUSTER

NLNRPLWNGLMAGLFPLTALVLALGLAALLKSPWALFPLRVLAGASLLLALLYPLTLPPEARGLLGLQERLAPWAGLLAAAGLRALLVLAGQWQGL-

5ezmA3

0.13

0.12

0.93

0.73

dPPAS

--SPRSWGKQLIGMAIVAACGLLASPVVATLNNSFYRAYAVWVAVAFVVMLLGIAV-----ARLLLRRGVLPSVAVYAMGMYLGFTVALLGETVGRP

5ezmA3

0.13

0.12

0.92

0.97

wdPPAS

--SPRSWGKQLIGMAIVAACGLLASPVVATLNNSFYRAYAVWVAVAFVVMLLGIAV-----ARLLLRRGVLPSVAVYAMGMYLGFTVALL-ETVGAS

2vpyC2

0.16

0.15

0.98

0.95

wMUSTER

LN-RPLWNGLMAGLFPLTALVLALGLAALLKSPWALFPLRVLAGASLLLALLYPLTLPPEEAGLLGLQERLAPWAGLLAAAGLRALLVLAGQWQGL-

4cgrA3

0.27

0.14

0.54

0.83

wPPAS

VAVRLAAS-------PRLHFAAAVAGASVRVAAEHWASGARPLEQALLNLEVLR--FAWEA------------------------------------

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 4 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-0.46

Estimated TM-score = 0.65±0.13

Estimated RMSD = 4.8±3.1Å

Download Model 2

C-score=-4.44

Download Model 3

C-score=-4.59

Download Model 4

C-score=-4.99

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	5ezmA	0.815	1.90	0.098	0.938
2	2v0oA	0.779	1.91	0.054	0.949
3	1i49A	0.764	2.36	0.043	0.969
4	5c1fA	0.753	2.45	0.053	0.969
5	4wpcA	0.750	2.19	0.033	0.949
6	3g9gA	0.740	2.59	0.032	0.969
7	1uruA	0.739	2.58	0.043	0.959
8	3sogA	0.737	2.54	0.043	0.949
9	4nqiA	0.735	2.38	0.043	0.959
10	2ficB	0.735	2.39	0.054	0.949

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.12	10	5dirC	MLE	Rep, Mult	14,17,18,50,54,88
2	0.07	6	4m70A	III	Rep, Mult	18,21,47,51
3	0.06	5	3ls1A	ZN	Rep, Mult	14,18,54
4	0.06	5	4w8pA	III	Rep, Mult	11,12,15,19,22,23,26,41,44,45,48,51,56,64
5	0.05	4	4qi1A	MPG	Rep, Mult	22,26,29,30,37,41,44,45,48,51
6	0.02	2	3rrpA	LMR	Rep, Mult	55,56,57,65
7	0.02	2	1bjyB	CTC	Rep, Mult	62,64,67
8	0.02	2	2ongA	MN	Rep, Mult	73,77
9	0.02	2	3mgrH	RB	Rep, Mult	54,55,57
10	0.02	2	4d2eD	78N	Rep, Mult	10,13,14,78,81,85
11	0.01	1	2q67A	CA	Rep, Mult	51,52
12	0.01	1	2a9iA	MN	Rep, Mult	70,73
13	0.01	1	5ahzA	BR	Rep, Mult	7,11,65,70,73
14	0.01	1	5ezmA	MPG	Rep, Mult	43,88
15	0.01	1	1gwgA	IOD	Rep, Mult	28,29,32,37

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.093	2w5jA	0.471	2.36	0.049	0.619	3.6.3.14	NA
2	0.078	1cxzB	0.549	2.20	0.125	0.649	2.7.11.13	NA
3	0.071	1a91A	0.493	2.53	0.047	0.660	3.6.3.14	NA
4	0.067	2h8aA	0.623	2.67	0.068	0.856	2.5.1.18	10,64
5	0.060	1fziA	0.674	2.61	0.033	0.897	1.14.13.25	NA
6	0.060	1mhyD	0.671	2.65	0.043	0.897	1.14.13.25	NA
7	0.060	3e04D	0.710	2.56	0.088	0.928	4.2.1.2	NA
8	0.060	3gzhA	0.644	2.97	0.066	0.907	4.3.2.2	NA
9	0.060	1dcnB	0.647	2.95	0.045	0.907	4.3.2.1	NA
10	0.060	1uzrB	0.632	2.79	0.077	0.876	1.17.4.1	NA
11	0.060	1yfmA	0.639	2.77	0.065	0.907	4.2.1.2	NA
12	0.060	3crlB	0.636	3.05	0.089	0.917	2.7.11.2	NA
13	0.060	2e9fB	0.710	2.81	0.086	0.949	4.3.2.1	NA
14	0.060	2qcxB	0.643	2.98	0.065	0.897	3.5.99.2	NA
15	0.060	3d2rB	0.634	3.35	0.078	0.928	2.7.11.2	NA
16	0.060	2pnrB	0.628	3.17	0.067	0.907	2.7.11.2	NA
17	0.060	1q5nA	0.654	3.21	0.116	0.928	5.5.1.2	81
18	0.060	1yisA	0.666	3.01	0.043	0.938	4.3.2.2	53
19	0.060	1xzpA	0.649	2.96	0.054	0.907	3.6.5.-	52
20	0.060	3gm1B	0.645	3.03	0.076	0.917	2.7.10.2	48,76
21	0.060	1krqA	0.639	3.04	0.034	0.897	1.16.3.1	53
22	0.060	2hvgA	0.651	3.04	0.084	0.928	4.3.2.2	NA
23	0.060	2v8tA	0.640	2.59	0.078	0.887	1.11.1.6	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.21	0.753	2.45	0.05	0.97	5c1fA	GO:0001786 GO:0005547 GO:0005737 GO:0005826 GO:0005829 GO:0005856 GO:0007049 GO:0007067 GO:0051301 GO:0070273 GO:1903475
1	0.20	0.779	1.91	0.05	0.95	2v0oA	GO:0001786 GO:0005546 GO:0005886 GO:0005905 GO:0006897 GO:0010324 GO:0016020 GO:0030136 GO:0035091 GO:0048268 GO:0072583 GO:0072659
2	0.18	0.695	2.54	0.06	0.94	2efkA	GO:0001891 GO:0005086 GO:0005096 GO:0005654 GO:0005737 GO:0005764 GO:0005794 GO:0005802 GO:0005829 GO:0005856 GO:0005886 GO:0005938 GO:0006897 GO:0007154 GO:0007165 GO:0008289 GO:0016020 GO:0016192 GO:0030036 GO:0042802 GO:0042995 GO:0043231 GO:0043547 GO:0048471 GO:0051056 GO:0070062
3	0.18	0.722	2.62	0.04	0.96	3q0kD	GO:0005215 GO:0005654 GO:0005737 GO:0005768 GO:0005769 GO:0005829 GO:0005856 GO:0005886 GO:0005901 GO:0005911 GO:0005913 GO:0005925 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019898 GO:0030036 GO:0030100 GO:0030659 GO:0031410 GO:0032587 GO:0036010 GO:0042802 GO:0042995 GO:0043231 GO:0045806 GO:0048858 GO:0055038 GO:0070062 GO:0070300 GO:0070836 GO:0072584 GO:0097320 GO:0098609 GO:0098641
4	0.18	0.731	2.47	0.05	0.96	3syvC	GO:0005654 GO:0005737 GO:0005768 GO:0005802 GO:0005886 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019855 GO:0045806 GO:0051044 GO:0051926 GO:0070062 GO:0097320
5	0.18	0.764	2.36	0.04	0.97	1i49A	GO:0001726 GO:0005525 GO:0005737 GO:0005829 GO:0005886 GO:0005913 GO:0005938 GO:0006928 GO:0007264 GO:0019904 GO:0030032 GO:0030036 GO:0030742 GO:0031529 GO:0032588 GO:0034315 GO:0048365 GO:0070273 GO:0098609 GO:0098641
6	0.17	0.701	2.69	0.04	0.96	3i2wA	GO:0000281 GO:0005543 GO:0005768 GO:0005829 GO:0005886 GO:0007053 GO:0007112 GO:0007269 GO:0008289 GO:0030100 GO:0030496 GO:0032154 GO:0036090 GO:0045211 GO:0045887 GO:0048488 GO:0061024 GO:0071212
7	0.17	0.690	2.93	0.07	0.96	3m3wB	GO:0005654 GO:0005737 GO:0005768 GO:0005802 GO:0005886 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019855 GO:0045806 GO:0051044 GO:0051926 GO:0070062 GO:0097320
8	0.16	0.722	2.70	0.04	0.96	4bneA	GO:0005737 GO:0005768 GO:0005769 GO:0005802 GO:0005829 GO:0005856 GO:0005886 GO:0005901 GO:0005925 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0030036 GO:0030054 GO:0030100 GO:0030659 GO:0031410 GO:0032587 GO:0042995 GO:0045806 GO:0055038 GO:0070300 GO:0070836 GO:0097320
9	0.16	0.699	2.71	0.04	0.96	3i2wB	GO:0000281 GO:0005543 GO:0005768 GO:0005829 GO:0005886 GO:0007053 GO:0007112 GO:0007269 GO:0008289 GO:0030100 GO:0030496 GO:0032154 GO:0036090 GO:0045211 GO:0045887 GO:0048488 GO:0061024 GO:0071212
10	0.15	0.741	2.31	0.04	0.96	2eflA	GO:0005086 GO:0005737 GO:0005764 GO:0005802 GO:0005856 GO:0005886 GO:0005905 GO:0005938 GO:0006897 GO:0008289 GO:0016020 GO:0016023 GO:0016192 GO:0031410 GO:0042802 GO:0043547
11	0.14	0.722	2.56	0.07	0.96	3syvB	GO:0005654 GO:0005737 GO:0005768 GO:0005802 GO:0005886 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019855 GO:0045806 GO:0051044 GO:0051926 GO:0070062 GO:0097320
12	0.13	0.740	2.59	0.03	0.97	3g9gA	GO:0000144 GO:0000147 GO:0001400 GO:0004857 GO:0005934 GO:0005935 GO:0006897 GO:0007049 GO:0032185 GO:0042802 GO:0043086 GO:0061645
13	0.12	0.810	1.83	0.10	0.93	5f15A	GO:0016020 GO:0016021 GO:0016740
14	0.11	0.723	2.60	0.02	0.96	3haiA	GO:0005543 GO:0005737 GO:0005768 GO:0005829 GO:0005886 GO:0006897 GO:0007015 GO:0008092 GO:0008289 GO:0016020 GO:0030054 GO:0030100 GO:0030137 GO:0030659 GO:0031410 GO:0032587 GO:0042995 GO:0043005 GO:0043209 GO:0043679 GO:0045202 GO:0045806 GO:0048471 GO:0048488 GO:0048666 GO:0048812 GO:0072657 GO:0090002 GO:0097320 GO:1900006
15	0.09	0.689	2.70	0.04	0.96	4wpeA	GO:0000142 GO:0000144 GO:0000281 GO:0000917 GO:0005737 GO:0005856 GO:0005935 GO:0007049 GO:0007067 GO:0008092 GO:0044697 GO:0051301 GO:0090339
16	0.07	0.735	2.66	0.07	0.96	3qniA	GO:0005543 GO:0005737 GO:0005768 GO:0005829 GO:0005886 GO:0006897 GO:0007015 GO:0008092 GO:0008289 GO:0016020 GO:0030054 GO:0030100 GO:0030137 GO:0030659 GO:0031410 GO:0032587 GO:0042995 GO:0043005 GO:0043209 GO:0043679 GO:0045202 GO:0045806 GO:0048471 GO:0048488 GO:0048666 GO:0048812 GO:0072657 GO:0090002 GO:0097320 GO:1900006
17	0.07	0.626	3.15	0.02	0.93	1ya9A	GO:0001523 GO:0001540 GO:0001937 GO:0002021 GO:0005319 GO:0005543 GO:0005576 GO:0005615 GO:0005634 GO:0005783 GO:0005794 GO:0005829 GO:0005886 GO:0006629 GO:0006641 GO:0006695 GO:0006707 GO:0006810 GO:0006869 GO:0006874 GO:0006898 GO:0006979 GO:0007186 GO:0007263 GO:0008104 GO:0008201 GO:0008203 GO:0008289 GO:0010468 GO:0010544 GO:0010873 GO:0010875 GO:0015485 GO:0015909 GO:0016020 GO:0016209 GO:0017038 GO:0017127 GO:0019068 GO:0019433 GO:0019934 GO:0030195 GO:0030516 GO:0030828 GO:0031012 GO:0031103 GO:0032374 GO:0032489 GO:0032805 GO:0033344 GO:0033700 GO:0034361 GO:0034362 GO:0034363 GO:0034364 GO:0034372 GO:0034374 GO:0034375 GO:0034380 GO:0034382 GO:0034384 GO:0034447 GO:0042157 GO:0042158 GO:0042159 GO:0042311 GO:0042627 GO:0042632 GO:0042802 GO:0042803 GO:0043407 GO:0043524 GO:0043537 GO:0043691 GO:0044794 GO:0045541 GO:0046889 GO:0046911 GO:0048156 GO:0048844 GO:0050728 GO:0050750 GO:0051000 GO:0051044 GO:0051055 GO:0051651 GO:0055088 GO:0055089 GO:0060228 GO:0060999 GO:0061000 GO:0070062 GO:0070326 GO:0071813 GO:0072358 GO:0072562 GO:0090370 GO:0097113 GO:0097114 GO:0098869 GO:1900221 GO:1901214 GO:1901215 GO:1901216 GO:1901627 GO:1901628 GO:1901630 GO:1901631 GO:1902004 GO:1902430 GO:1902947 GO:1902951 GO:1902952 GO:1902995 GO:1902998 GO:1902999 GO:1903001 GO:1903002 GO:1903561
18	0.07	0.406	2.92	0.00	0.58	3iu6A	GO:0000228 GO:0003677 GO:0003682 GO:0005634 GO:0005654 GO:0006338 GO:0006351 GO:0006355 GO:0007067 GO:0008285 GO:0016568 GO:0090544

Consensus prediction of GO terms

Molecular Function	GO:1902936	GO:0001786	GO:0005085	GO:0030695	GO:0008047	GO:0045296	GO:0098632	GO:0043168	GO:0005246	GO:0008200	GO:0042802	GO:0008092
GO-Score	0.39	0.37	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.33	0.33
Biological Processes	GO:0000280	GO:0000915	GO:1902407	GO:0043623	GO:1990778	GO:0072657	GO:0006898	GO:0043087	GO:0007264	GO:0051345	GO:1902531	GO:0044854	GO:0007155	GO:0032990	GO:0000902	GO:0030030	GO:0072665	GO:0051043	GO:0043271	GO:0045732	GO:0031331	GO:0045862	GO:0051924	GO:0097320	GO:0045806
GO-Score	0.42	0.42	0.42	0.39	0.39	0.39	0.39	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.33	0.33
Cellular Component	GO:0005829	GO:0005654	GO:0070062	GO:0030864	GO:0032155	GO:0070938	GO:0030135	GO:0000323	GO:0005924	GO:0044853	GO:0010008	GO:0044433	GO:0055037	GO:0005911	GO:0031253	GO:0001726	GO:0012506	GO:0031256	GO:0005802
GO-Score	0.47	0.45	0.45	0.42	0.42	0.42	0.39	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.33

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv3355c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]