| >protein (69 residues) MITVLDMNGFKDARPDRLPLSASVWDIAQRYNKGGPTVTEALYEALKELEAQVIALQRSE GKGLLSRLS |
| Sequence |
20 40 60 | | | MITVLDMNGFKDARPDRLPLSASVWDIAQRYNKGGPTVTEALYEALKELEAQVIALQRSEGKGLLSRLS |
| Prediction | CCCEEHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCC |
| Conf.Score | 975665678877899888876448999998777885789999999999999999988755765666559 |
| H:Helix; S:Strand; C:Coil | |
| Sequence |
20 40 60 | | | MITVLDMNGFKDARPDRLPLSASVWDIAQRYNKGGPTVTEALYEALKELEAQVIALQRSEGKGLLSRLS |
| Prediction | 723134344266344641414341240054266433302520252056153422314366244225538 |
| Values range from 0 (buried residue) to 8 (highly exposed residue) | |
(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)
![]() |
| Rank | PDB Hit | Iden1 | Iden2 | Cov | Norm. Zscore | DownloadAlign. | 20 40 60 | | | | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Sec.Str Seq | CCCEEHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCC MITVLDMNGFKDARPDRLPLSASVWDIAQRYNKGGPTVTEALYEALKELEAQVIALQRSEGKGLLSRLS | |||||||||||||||||
| 1 | 4malA | 0.29 | 0.25 | 0.84 | 0.86 | MUSTER | ---TDDFDFLSGADE-----AATKLDLARAYIDGD---SEGARDILDEVLAEGNDSQQAEARELLERLA | |||||||||||
| 2 | 4malA | 0.29 | 0.25 | 0.84 | 0.83 | dPPAS | ---TDDFDFLSGADE-----AATKLDLARAYIDGD---SEGARDILDEVLAEGNDSQQAEARELLERLA | |||||||||||
| 3 | 4malA | 0.30 | 0.25 | 0.83 | 0.86 | wdPPAS | ---TDDFDFLSGADE-----AATKLDLARAYIDG----SEGARDILDEVLAEGNDSQQAEARELLERLA | |||||||||||
| 4 | 4malA | 0.31 | 0.25 | 0.80 | 0.85 | wMUSTER | ---TDDFDFLSGADE------ATKLDLARAYIDGD---SEGARDILDEVLAE--DSQQAEARELLERLA | |||||||||||
| 5 | 4malA | 0.34 | 0.26 | 0.77 | 0.77 | wPPAS | --T--DFDFLSGADE------ATKLDLARAYIDG----SEGARDILDEVLAE--DSQQAEARELLERLA | |||||||||||
| 6 | 4malA | 0.29 | 0.25 | 0.84 | 0.90 | dPPAS2 | ---TDDFDFLSGADE-----AATKLDLARAYIDGD---SEGARDILDEVLAEGNDSQQAEARELLERLA | |||||||||||
| 7 | 4malA | 0.30 | 0.25 | 0.81 | 0.97 | PPAS | ---TDDFDFLSGADE------ATKLDLARAYIDG----SEGARDILDEVLAEGNDSQQAEARELLERLA | |||||||||||
| 8 | 4malA | 0.29 | 0.25 | 0.84 | 1.06 | Env-PPAS | ---TDDFDFLSGADE-----AATKLDLARAYIDGD---SEGARDILDEVLAEGNDSQQAEARELLERLA | |||||||||||
| 9 | 4cj9A5 | 0.20 | 0.17 | 0.87 | 0.66 | MUSTER | LEPALGKRGFS---------RIDIVKIAANNGAQALHAVLDLGPTLRECQATIAKIAGNIGAQALQVLD | |||||||||||
| 10 | 4wwrA | 0.26 | 0.20 | 0.77 | 0.61 | dPPAS | ---------------MQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLR-SDIQKRLQ | |||||||||||
| ||||||||||||||||||
Download Model 1
|
Download Model 2
|
Download Model 3
|
Download Model 4
|
Download Model 5
|
(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)
Top 10 Identified stuctural analogs in PDB
|
(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)
| Enzyme Commission (EC) numbers and active sites |
| Rank | CscoreEC | PDB Hit | TM-score | RMSDa | IDENa | Cov | EC Number | Active Site Residues |
|---|---|---|---|---|---|---|---|---|
| 1 | 0.060 | 3gzkA | 0.604 | 2.82 | 0.118 | 0.942 | 3.2.1.4 | NA |
| 2 | 0.060 | 1g87B | 0.631 | 2.46 | 0.118 | 0.942 | 3.2.1.4 | NA |
| 3 | 0.060 | 1w6jA | 0.604 | 2.90 | 0.116 | 0.884 | 5.4.99.7 | NA |
| 4 | 0.060 | 2pfdB | 0.647 | 2.69 | 0.162 | 0.986 | 2.1.2.5,4.3.1.4 | NA |
| 5 | 0.060 | 3cirA | 0.644 | 2.18 | 0.058 | 0.812 | 1.3.99.1 | 30 |
| 6 | 0.060 | 3cirM | 0.630 | 2.32 | 0.058 | 0.812 | 1.3.99.1 | NA |
| 7 | 0.060 | 3c5wA | 0.639 | 2.50 | 0.136 | 0.942 | 3.1.3.16 | NA |
| 8 | 0.060 | 3ebgA | 0.631 | 2.78 | 0.061 | 0.957 | 3.4.11.- | NA |
| 9 | 0.060 | 1fp3A | 0.606 | 2.80 | 0.132 | 0.942 | 5.1.3.8 | NA |
| 10 | 0.060 | 1nekA | 0.645 | 1.91 | 0.101 | 0.797 | 1.3.99.1, | NA |
| 11 | 0.060 | 1e7pA | 0.663 | 2.04 | 0.130 | 0.812 | 1.3.99.1 | NA |
| 12 | 0.060 | 1chuA | 0.643 | 2.05 | 0.087 | 0.797 | 1.4.3.16 | 17 |
| 13 | 0.060 | 1wao1 | 0.607 | 2.56 | 0.033 | 0.841 | 3.1.3.16 | NA |
| 14 | 0.060 | 1ayxA | 0.639 | 2.60 | 0.045 | 0.927 | 3.2.1.3 | 40 |
| 15 | 0.060 | 1w3bA | 0.611 | 2.21 | 0.083 | 0.812 | 2.4.1.- | NA |
| 16 | 0.060 | 1ihgA | 0.665 | 2.03 | 0.049 | 0.884 | 5.2.1.8 | 49 |
| 17 | 0.060 | 2wdqA | 0.632 | 1.97 | 0.087 | 0.797 | 1.3.99.1 | NA |
| 18 | 0.060 | 1j0mA | 0.629 | 3.58 | 0.072 | 1.000 | 4.2.2.12 | NA |
| 19 | 0.060 | 1kt1A | 0.625 | 3.22 | 0.058 | 0.986 | 5.2.1.8 | NA |
| (a) | CscoreEC is the confidence score for the EC number prediction. CscoreEC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction. |
| (b) | TM-score is a measure of global structural similarity between query and template protein. |
| (c) | RMSDa is the RMSD between residues that are structurally aligned by TM-align. |
| (d) | IDENa is the percentage sequence identity in the structurally aligned region. |
| (e) | Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein. |
| Please cite the following articles when you use the I-TASSER server: | |
| 1. | J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015. |
| 2. | J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015. |
| 3. | A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010. |
| 4. | Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008. |