I-TASSER results

Input Sequence in FASTA format

>protein (132 residues)
MDYAFLPPEINSARMYSGPGPNSMLVAAASWDALAAELASAAENYGSVIARLTGMHWWGP
ASTSMLAMSAPYVEWLERTAAQTKQTATQARAAAAAFEQAHAMTVPPALVTGIRGAIVVE
TASASNTAGTPP

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 \| \| \| \| \| \| MDYAFLPPEINSARMYSGPGPNSMLVAAASWDALAAELASAAENYGSVIARLTGMHWWGPASTSMLAMSAPYVEWLERTAAQTKQTATQARAAAAAFEQAHAMTVPPALVTGIRGAIVVETASASNTAGTPP
Prediction	CCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCC
Conf.Score	986668846665545789996899999999999999999999999999998765776788999999999999999999999999999999999999999998599989999999999999999755799999
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 \| \| \| \| \| \| MDYAFLPPEINSARMYSGPGPNSMLVAAASWDALAAELASAAENYGSVIARLTGMHWWGPASTSMLAMSAPYVEWLERTAAQTKQTATQARAAAAAFEQAHAMTVPPALVTGIRGAIVVETASASNTAGTPP
Prediction	673443221221231342423230230133034004413310431332022344441312003301300321342034004304421330421010132034233434313323432130312233344338
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120

                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCC
MDYAFLPPEINSARMYSGPGPNSMLVAAASWDALAAELASAAENYGSVIARLTGMHWWGPASTSMLAMSAPYVEWLERTAAQTKQTATQARAAAAAFEQAHAMTVPPALVTGIRGAIVVETASASNTAGTPP

2g38B

0.29

0.98

2.31

MUSTER

-AFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSL-MDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAHHDMVPLAQIYNNRAERQILIDNNALGQFTAQ

2g38B

0.29

0.98

2.24

dPPAS

-AFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSL-MDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAHHDMVPLAQIYNNRAERQILIDNNALGQFTAQ

2g38B

0.29

0.98

3.39

wdPPAS

-AFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSL-MDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAHHDMVPLAQIYNNRAERQILIDNNALGQFTAQ

2g38B

0.29

0.98

2.80

wMUSTER

--FEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSL-MDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAHHDMVPLAQIYNNRAERQILIDNNALGQFTAQ

2g38B

0.29

0.98

4.07

wPPAS

-AFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSL-MDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAHHDMVPLAQIYNNRAERQILIDNNALGQFTAQ

2g38B

0.29

0.98

5.50

dPPAS2

-AFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSL-MDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAHHDMVPLAQIYNNRAERQILIDNNALGQFTAQ

2g38B

0.29

0.98

3.19

PPAS

-AFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSL-MDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAHHDMVPLAQIYNNRAERQILIDNNALGQFTAQ

2g38B

0.29

0.98

4.90

Env-PPAS

-AFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSL-MDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAHHDMVPLAQIYNNRAERQILIDNNALGQFTAQ

5cwpA1

0.12

0.10

0.82

0.81

MUSTER

----------------MSSDEEEARELIERAKEAAERAQEAAERTDPRVRELAR-----ELKRLAQEAAEEVKR-SSDVNEALKLIVEAIEAAVRALEAAERTGDPEVRELARELVRLAVEAAEEVQRNP--

3zbhA

0.13

0.09

0.68

0.78

dPPAS

------------------LTPEELRGVARQYNVESSNVTELIARLDQMSHTLQG-IWEGASSEAFIQQYQELRPSFEKMAVLLNEVGQQLHNSATILEDTDQQIASQIR-----------------------

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=1.17

Estimated TM-score = 0.88±0.07

Estimated RMSD = 2.3±1.8Å

Download Model 2

C-score=-2.65

Download Model 3

C-score=-4.76

Download Model 4

C-score=-4.72

Download Model 5

C-score=-4.33

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	2g38B	0.940	1.03	0.292	0.985
2	4xwpA	0.761	2.19	0.150	0.886
3	1qu7A	0.735	2.62	0.045	0.909
4	1y2oA	0.715	3.19	0.094	0.932
5	2ch7A	0.715	2.63	0.076	0.901
6	3g67A	0.703	2.65	0.046	0.909
7	5dn6G	0.695	2.63	0.082	0.886
8	4wj1A	0.690	2.58	0.140	0.864
9	4nqiA	0.687	2.84	0.117	0.901
10	4e40A	0.682	3.07	0.123	0.924

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.07	3	5da5E	GOA	Rep, Mult	37,41,76
2	0.05	2	4n7kL	LDA	Rep, Mult	30,31,90
3	0.05	2	2jj1G	PIT	Rep, Mult	42,45,46,49,50
4	0.05	2	2vs0B	ZN	Rep, Mult	36,84
5	0.04	2	1hjbA	NUC	Rep, Mult	71,72,75,76,78,79,82
6	0.02	1	3io4C	CA	Rep, Mult	94,97,98
7	0.02	1	3sjqC	PHU	Rep, Mult	100,103
8	0.02	1	1xrrA	PRO	Rep, Mult	68,72,101,107,108
9	0.02	1	1xvbB	BBX	Rep, Mult	27,31,105
10	0.02	1	3k7tA	GP7	Rep, Mult	19,20
11	0.02	1	1f8rC	UUU	Rep, Mult	69,72
12	0.02	1	2hydA	NA	Rep, Mult	123,124,126,130
13	0.02	1	1vm1A	TAZ	Rep, Mult	3,9
14	0.02	1	2g381	III	Rep, Mult	3,14,15,17,18,19,20,23,24,27,30,31,33,34,37,38,40,41,44,45,48,52,57,65,72,75,83,86,90,97
15	0.02	1	1xrpA	III	Rep, Mult	65,72,92,95,96,101
16	0.02	1	3c9iC	XE	Rep, Mult	97,100
17	0.02	1	3io6A	CA	Rep, Mult	9,12

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.189	1cxzB	0.456	2.33	0.047	0.545	2.7.11.13	38,42
2	0.126	1urfA	0.461	2.73	0.101	0.576	2.7.11.13	85
3	0.060	1qd1B	0.256	4.66	0.069	0.455	2.1.2.5,4.3.1.4	NA
4	0.060	1tj7A	0.509	2.78	0.071	0.644	4.3.2.1	NA
5	0.060	1wleB	0.531	3.07	0.038	0.697	6.1.1.11	43
6	0.060	2iw5A	0.596	3.87	0.038	0.901	1.-.-.-	NA
7	0.060	1is2A	0.508	2.94	0.063	0.636	1.3.3.6	NA
8	0.060	3i9wA	0.607	2.98	0.055	0.788	2.7.13.3	33,38
9	0.060	2pfdB	0.506	3.01	0.054	0.667	2.1.2.5,4.3.1.4	6
10	0.060	2o6yA	0.506	3.84	0.070	0.720	4.3.1.-	NA
11	0.060	2b5uA	0.656	3.35	0.053	0.924	3.1.-.-	32
12	0.060	1w07B	0.548	2.56	0.070	0.659	1.3.3.6	NA
13	0.060	2fenD	0.502	3.11	0.080	0.651	5.5.1.2	NA
14	0.060	1z0hB	0.243	5.46	0.000	0.485	3.4.24.69	74
15	0.060	1vdkA	0.518	2.76	0.056	0.651	4.2.1.2	NA
16	0.060	2pmzQ	0.511	3.94	0.044	0.705	2.7.7.6	14,111
17	0.060	1a31A	0.366	4.09	0.044	0.591	5.99.1.2	91
18	0.060	1p49A	0.551	3.92	0.042	0.826	3.1.6.2	NA
19	0.060	2fonB	0.551	2.60	0.063	0.659	1.3.3.6	NA
20	0.060	1c3cA	0.501	2.64	0.039	0.629	4.3.2.2	NA
21	0.060	2zr3B	0.560	3.05	0.016	0.727	6.1.1.11	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.42	0.917	1.31	0.30	0.99	4kxrB	GO:0005576 GO:0009405 GO:0009986
1	0.25	0.739	2.30	0.07	0.91	3zx6A	GO:0004871 GO:0004888 GO:0005886 GO:0005887 GO:0006935 GO:0007165 GO:0016020 GO:0016021 GO:0043200 GO:0043424 GO:0046872 GO:0048870
2	0.24	0.703	2.65	0.05	0.91	3g67A	GO:0004871 GO:0007165 GO:0016020
3	0.21	0.363	2.13	0.12	0.42	4jzlA	GO:0000139 GO:0002474 GO:0005739 GO:0005783 GO:0005784 GO:0005789 GO:0005811 GO:0005829 GO:0005887 GO:0006810 GO:0006886 GO:0006888 GO:0006915 GO:0006921 GO:0007204 GO:0007283 GO:0015031 GO:0016020 GO:0016021 GO:0016192 GO:0030136 GO:0032403 GO:0032471 GO:0032580 GO:0033116 GO:0035584 GO:0042288 GO:0043280 GO:0051561 GO:0070973 GO:0071556 GO:0097038 GO:1903071 GO:1904154 GO:2001244
4	0.19	0.609	2.39	0.10	0.71	2vrzA	GO:0005576 GO:0009405
5	0.16	0.661	2.90	0.08	0.88	4xxxA	GO:0005576 GO:0009405 GO:0044315
6	0.14	0.725	2.39	0.16	0.89	3j83A	GO:0005576 GO:0009405 GO:0044315
7	0.13	0.684	3.12	0.08	0.95	1y2oA	GO:0001726 GO:0005737 GO:0005829 GO:0005856 GO:0005886 GO:0005913 GO:0007009 GO:0007409 GO:0008022 GO:0008093 GO:0008286 GO:0008360 GO:0009617 GO:0014069 GO:0015629 GO:0016020 GO:0016358 GO:0030141 GO:0030165 GO:0030175 GO:0030838 GO:0032956 GO:0038096 GO:0042802 GO:0042995 GO:0043005 GO:0043025 GO:0043197 GO:0048010 GO:0048167 GO:0051017 GO:0051764 GO:0061003 GO:0070062 GO:0070064 GO:0097481 GO:0098609 GO:0098641 GO:2000251
8	0.11	0.715	2.63	0.08	0.90	2ch7A	GO:0004871 GO:0005886 GO:0006935 GO:0007165 GO:0016020 GO:0016021
9	0.11	0.499	2.96	0.03	0.65	1envA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0002223 GO:0003677 GO:0003682 GO:0003700 GO:0005198 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0019064 GO:0019082 GO:0020002 GO:0030683 GO:0033644 GO:0039654 GO:0039663 GO:0042802 GO:0043565 GO:0044174 GO:0044175 GO:0045899 GO:0046718 GO:0055036 GO:0060261 GO:0075509 GO:0075512 GO:1903833
10	0.11	0.710	2.84	0.05	0.89	2d1lA	GO:0001701 GO:0002230 GO:0003779 GO:0003785 GO:0005102 GO:0005737 GO:0005856 GO:0005912 GO:0007009 GO:0007015 GO:0007399 GO:0007517 GO:0010960 GO:0015629 GO:0030036 GO:0030041 GO:0030282 GO:0032233 GO:0034334 GO:0042802 GO:0050680 GO:0051015 GO:0061333 GO:0071498 GO:0072001 GO:0072102 GO:0072160 GO:0098792 GO:2001013
11	0.11	0.422	2.31	0.11	0.50	4bl6C	GO:0003729 GO:0005737 GO:0005794 GO:0005829 GO:0005856 GO:0006810 GO:0007275 GO:0007293 GO:0007294 GO:0007309 GO:0007310 GO:0007312 GO:0007314 GO:0008103 GO:0008298 GO:0016325 GO:0017137 GO:0019233 GO:0030100 GO:0030154 GO:0030669 GO:0030727 GO:0032050 GO:0045502 GO:0048477 GO:0048488 GO:0050658 GO:0051028 GO:0070727 GO:2000302 GO:2000370
12	0.10	0.660	3.31	0.04	0.92	3ok8A	GO:0005543 GO:0005829 GO:0005886 GO:0007009 GO:0008093 GO:0008286 GO:0008289 GO:0012506 GO:0015629 GO:0016020 GO:0030054 GO:0030659 GO:0030838 GO:0031410 GO:0044291 GO:0051017 GO:0051764 GO:0061024 GO:0071439 GO:2000251
13	0.10	0.465	2.84	0.06	0.61	2oszA	GO:0005487 GO:0005634 GO:0005635 GO:0005643 GO:0006810 GO:0006913 GO:0008139 GO:0015031 GO:0016020 GO:0031965 GO:0042306 GO:0043234 GO:0051028 GO:0051260 GO:0051290 GO:0051291 GO:0070208
14	0.07	0.515	3.07	0.06	0.67	4uxvA	GO:0000921 GO:0005886 GO:0005940 GO:0007049 GO:0016020 GO:0016021 GO:0051301 GO:0051781
15	0.06	0.427	2.26	0.06	0.51	2c2jA	GO:0005737 GO:0006879 GO:0006950 GO:0008199 GO:0016491 GO:0046872 GO:0055114
16	0.06	0.398	1.93	0.05	0.46	2npsD	GO:0000139 GO:0005484 GO:0005769 GO:0005794 GO:0005802 GO:0005829 GO:0005886 GO:0006810 GO:0006886 GO:0006906 GO:0007032 GO:0015031 GO:0016020 GO:0016021 GO:0016192 GO:0019905 GO:0030136 GO:0031201 GO:0032456 GO:0032588 GO:0032880 GO:0042147 GO:0043195 GO:0045335 GO:0048193 GO:0048278 GO:0048471 GO:0090161 GO:1903827
17	0.06	0.419	4.01	0.03	0.67	5a20A	GO:0019012 GO:0019028 GO:0019076 GO:0046718 GO:0046729
18	0.06	0.403	3.90	0.03	0.61	2jesA	GO:0019012 GO:0019028 GO:0019076 GO:0046718 GO:0046729
19	0.06	0.350	2.45	0.08	0.44	5fvlA	GO:0000166 GO:0005524 GO:0005634 GO:0005768 GO:0006810 GO:0007033 GO:0008568 GO:0010008 GO:0015031 GO:0016020 GO:0016125 GO:0016236 GO:0016887 GO:0031122 GO:0032511 GO:0042802 GO:0042803 GO:0045053 GO:0045324 GO:0051260 GO:0070676 GO:1990621

Consensus prediction of GO terms

Molecular Function	GO:0099600	GO:0043169	GO:0038023	GO:0019901	GO:0042287	GO:0044877
GO-Score	0.50	0.50	0.50	0.50	0.43	0.43
Biological Processes	GO:0009405	GO:0001101	GO:1901700	GO:0010243	GO:0042330	GO:0006928	GO:0051674	GO:0051560	GO:0097194	GO:1902533	GO:0070972	GO:0048002	GO:0070863	GO:1904152	GO:1904294	GO:2001056	GO:1903069	GO:0051480	GO:0032469	GO:2001235	GO:0022411	GO:0048193	GO:0048232	GO:0043281	GO:0032436	GO:0019722	GO:2001242
GO-Score	0.53	0.50	0.50	0.50	0.50	0.50	0.50	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43
Cellular Component	GO:0005576	GO:0030176	GO:0048471	GO:0031985	GO:0005793	GO:0030135	GO:0071256	GO:0098553	GO:0043232	GO:0009986	GO:0005887
GO-Score	0.53	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.42	0.41

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv3135

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]