I-TASSER results

I-TASSER results for job id Rv2717c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Input Sequence in FASTA format

>protein (164 residues)
MTRDLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVAD
GKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAP
TAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 \| \| \| \| \| \| \| \| MTRDLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR
Prediction	CCCCCCHHHHHHHHHCEEEEEEEEHCCCCCCCCEEEEEEEEHCCCCCCEEEEEEEEHCCCCCCCEEEEEEEEHCCCCEEEEEEEHCCCEEEEEEEEHCCCCCEEEEEEEHCCCEEEEHCCCCCCEEEEEEEEEEHCCEEEEEEEEEHCCCCCEEEEEEEEEHCC
Conf.Score	99877878888876564899988984898887556799999858998589999999778999754678889978999799999958997999987766789889999974454556757887655667999997699789999998589996546899999869
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 \| \| \| \| \| \| \| \| MTRDLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR
Prediction	85771364030013011303141416147376151313030335343303012302426574212301010104574401000023423012220325276530303244434443243453550440312031466402121213257450353030304468
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160

                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCHHHHHHHHHCEEEEEEEEHCCCCCCCCEEEEEEEEHCCCCCCEEEEEEEEHCCCCCCCEEEEEEEEHCCCCEEEEEEEHCCCEEEEEEEEHCCCCCEEEEEEEHCCCEEEEHCCCCCCEEEEEEEEEEHCCEEEEEEEEEHCCCCCEEEEEEEEEHCC
MTRDLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

2fr2A

1.00

0.98

3.98

MUSTER

---DLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

2fr2A

1.00

0.98

6.73

dPPAS

---DLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

2fr2A

1.00

0.98

7.06

wdPPAS

---DLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

2fr2A

1.00

0.98

4.53

wMUSTER

----LAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

2fr2A

1.00

0.98

6.33

wPPAS

---DLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

2fr2A

1.00

0.98

13.57

dPPAS2

---DLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

2fr2A

1.00

0.98

5.56

PPAS

---DLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

2fr2A

1.00

0.98

7.15

Env-PPAS

---DLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

2q4nA

0.39

0.36

0.92

3.38

MUSTER

--PPVHPFVAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESGAP-HAESGYFRPRPDGSIEVVIAQSTGLVEVQKGTYNVDEQSIKLKSDLVGN--------ASKVKEISREFELVDGKLSYVVRSTT-TNPLQPHLKAILDKL-

2q4nA

0.39

0.36

0.92

5.63

dPPAS

--PPVHPFVAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESGAP-HAESGYFRPRPDGSIEVVIAQSTGLVEVQKGTYNVDEQSIKLKSDLVGN--------ASKVKEISREFELVDGKLSYVVRSTT-TNPLQPHLKAILDKL-

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 1 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=1.96

Estimated TM-score = 0.99±0.04

Estimated RMSD = 1.3±1.3Å

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	2fr2A	0.972	0.50	1.000	0.982
2	2q4nA	0.872	1.28	0.391	0.921
3	3ia8A	0.868	1.19	0.333	0.915
4	2fwvA	0.846	1.76	0.294	0.933
5	1i78A	0.701	3.30	0.039	0.902
6	1k24A	0.670	3.75	0.039	0.915
7	4meeA	0.666	3.52	0.063	0.878
8	3aehA	0.665	3.39	0.063	0.866
9	4tq2A	0.665	3.17	0.103	0.848
10	3kvnX2	0.662	3.73	0.038	0.902

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.48	6	3emmA	HEM	Rep, Mult	29,33,35,55,65,85,89,124,125,128,130,143,145,155,156
2	0.08	3	1opbB	RET	Rep, Mult	25,37,39,53,130,132,141,143
3	0.07	2	3wjcB	RMD	Rep, Mult	53,65,67,85,87,89,145,155
4	0.05	2	3elzA	CHD	Rep, Mult	51,53,71,83,84,85,95,106,108,130,132
5	0.03	1	1uynX	CXE	Rep, Mult	132,134,136,139,141
6	0.03	1	1qd6D	HDS	Rep, Mult	69,81,91,93,94,95
7	0.03	1	1xca0	III	Rep, Mult	22,24,27,133,135,138,140,154,155,157,159
8	0.03	1	2x55A	C8E	Rep, Mult	21,159,161
9	0.03	1	3fidB	CXE	Rep, Mult	104,106,132,134,141
10	0.03	1	1ab00	III	Rep, Mult	17,18,40,42,44,52,54,162

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	1u5uA	0.512	4.21	0.056	0.750	4.2.1.92	50
2	0.060	1i78A	0.701	3.30	0.039	0.902	3.4.23.49	NA
3	0.060	1qwlA	0.533	4.03	0.084	0.768	1.11.1.6	NA
4	0.060	2e4jA	0.477	5.07	0.099	0.805	5.3.99.2	16,40,42,49,132
5	0.060	3dy5A	0.513	4.19	0.056	0.744	1.13.11.40,4.2.1.92	NA
6	0.060	1n63B	0.464	4.63	0.030	0.756	1.2.99.2	NA
7	0.060	1ye9M	0.246	5.23	0.000	0.408	1.11.1.6	47,49
8	0.060	3ej6D	0.515	4.56	0.090	0.799	1.11.1.6	NA
9	0.060	1rm6A	0.458	5.00	0.057	0.774	1.3.99.20	NA
10	0.060	1eulA	0.419	5.37	0.040	0.695	3.6.3.8	NA
11	0.060	1qqwB	0.529	4.06	0.092	0.762	1.11.1.6	NA
12	0.060	1ye9A	0.396	4.20	0.059	0.585	1.11.1.6	NA
13	0.060	3kvnX	0.662	3.74	0.038	0.902	3.1.1.1	143
14	0.060	1m7sA	0.537	4.06	0.076	0.768	1.11.1.6	NA
15	0.060	3fg3A	0.349	4.78	0.026	0.573	4.2.1.92,1.13.11.40	NA
16	0.060	1ye9K	0.396	4.19	0.078	0.585	1.11.1.6	NA
17	0.060	1sy7B	0.526	4.07	0.068	0.762	1.11.1.6	140
18	0.060	2htaA	0.466	4.23	0.060	0.671	5.1.3.-	NA
19	0.060	3ej6A	0.502	4.77	0.082	0.817	1.11.1.6	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.71	0.972	0.50	1.00	0.98	2fr2A	GO:0006810
1	0.45	0.846	1.76	0.29	0.93	2fwvA	GO:0005886 GO:0006810
2	0.44	0.886	1.36	0.37	0.94	3wjeB	GO:0005737 GO:0005829 GO:0006810
3	0.41	0.903	1.18	0.33	0.95	3ia8A	GO:0003676 GO:0003677 GO:0046872
4	0.20	0.574	3.17	0.12	0.74	2qm9A	GO:0001816 GO:0005215 GO:0005504 GO:0005634 GO:0005654 GO:0005737 GO:0006469 GO:0006810 GO:0008289 GO:0042632 GO:0045892 GO:0050727 GO:0050729 GO:0050872 GO:0050873 GO:0070062 GO:0071285 GO:0071356
5	0.17	0.696	3.24	0.06	0.91	2vdfA	GO:0004190 GO:0006508
6	0.17	0.534	3.38	0.07	0.71	2a0aA	GO:0005215 GO:0006810 GO:0008289
7	0.16	0.545	2.93	0.09	0.70	2lbaA	GO:0005215 GO:0005737 GO:0006810 GO:0008206 GO:0008289 GO:0032052
8	0.15	0.576	3.25	0.09	0.76	4i3bA	GO:0005215 GO:0005737 GO:0006810 GO:0008218 GO:0008289
9	0.15	0.565	3.09	0.08	0.73	1bwyA	GO:0005215 GO:0005615 GO:0005737 GO:0005739 GO:0005759 GO:0006810 GO:0008092 GO:0008289 GO:0036041 GO:0070062 GO:0070538
10	0.15	0.524	3.58	0.09	0.73	2mo5A	GO:0005215 GO:0005504 GO:0005622 GO:0005737 GO:0005829 GO:0006810 GO:0007586 GO:0008289 GO:0019433
11	0.15	0.506	3.93	0.10	0.73	1b4mA	GO:0005215 GO:0005737 GO:0005829 GO:0006776 GO:0006810 GO:0008289 GO:0016918 GO:0019841 GO:0042572
12	0.15	0.570	3.01	0.14	0.73	1gglA	GO:0005215 GO:0005501 GO:0005737 GO:0006810 GO:0008289 GO:0016918 GO:0019841 GO:0070062
13	0.15	0.539	2.98	0.12	0.69	2jn3A	GO:0005215 GO:0005504 GO:0005737 GO:0006810 GO:0008289
14	0.14	0.565	2.70	0.10	0.70	2ju3A	GO:0002230 GO:0003682 GO:0005215 GO:0005324 GO:0005504 GO:0005543 GO:0005634 GO:0005654 GO:0005737 GO:0005782 GO:0005829 GO:0006810 GO:0007067 GO:0008144 GO:0008284 GO:0008289 GO:0015909 GO:0016209 GO:0032000 GO:0032052 GO:0043066 GO:0043154 GO:0043234 GO:0045179 GO:0050892 GO:0051345 GO:0051977 GO:0051978 GO:0070062 GO:0070301 GO:0071456 GO:0098779 GO:0098792 GO:0098869
15	0.14	0.573	3.02	0.08	0.73	1yivA	GO:0005215 GO:0005737 GO:0006810 GO:0008289 GO:0043209 GO:0061024
16	0.14	0.561	3.37	0.11	0.74	5hzqA	GO:0001972 GO:0005215 GO:0005501 GO:0005634 GO:0005654 GO:0005737 GO:0005783 GO:0005829 GO:0006355 GO:0006810 GO:0007165 GO:0008289 GO:0008544 GO:0016918 GO:0019841 GO:0035115 GO:0042573 GO:0048385 GO:0048672 GO:0070062
17	0.14	0.561	3.06	0.08	0.73	3pptA	GO:0005215 GO:0006810 GO:0008289
18	0.13	0.582	3.08	0.09	0.74	3nr3A	GO:0005215 GO:0005504 GO:0005737 GO:0006810 GO:0008289 GO:0015485 GO:0043209 GO:0061024 GO:0070062
19	0.13	0.571	3.21	0.15	0.75	3elzB	GO:0005215 GO:0005737 GO:0006810 GO:0008206 GO:0008289 GO:0032052
20	0.13	0.562	3.11	0.10	0.73	5ha1A	GO:0001523 GO:0002138 GO:0005215 GO:0005501 GO:0005654 GO:0005737 GO:0005829 GO:0006776 GO:0006810 GO:0008289 GO:0016918 GO:0019841
21	0.13	0.670	3.75	0.04	0.91	1k24A	GO:0004190 GO:0006508 GO:0046872
22	0.12	0.561	3.30	0.10	0.73	3rswA	GO:0005215 GO:0005324 GO:0005504 GO:0005615 GO:0005737 GO:0005829 GO:0006631 GO:0006810 GO:0008092 GO:0008285 GO:0008289 GO:0015909 GO:0016528 GO:0019433 GO:0032868 GO:0036041 GO:0042493 GO:0042632 GO:0044539 GO:0046320 GO:0050543 GO:0055091 GO:0070062 GO:0070538 GO:0070542 GO:0071073
23	0.12	0.701	3.30	0.04	0.90	1i78A	GO:0004175 GO:0004190 GO:0004252 GO:0006508 GO:0008233 GO:0009279 GO:0016020 GO:0016021 GO:0016787 GO:0031230
24	0.11	0.538	4.68	0.08	0.91	2x4mA	GO:0004175 GO:0004190 GO:0006508 GO:0007599 GO:0008233 GO:0009279 GO:0016020 GO:0016021 GO:0016787 GO:0042730
25	0.10	0.573	3.14	0.09	0.73	2f73B	GO:0002230 GO:0003682 GO:0005215 GO:0005324 GO:0005504 GO:0005543 GO:0005634 GO:0005654 GO:0005737 GO:0005782 GO:0005829 GO:0006810 GO:0008144 GO:0008284 GO:0008289 GO:0015909 GO:0016209 GO:0019433 GO:0032000 GO:0032052 GO:0043066 GO:0043154 GO:0044255 GO:0045179 GO:0050892 GO:0051345 GO:0070062 GO:0070301 GO:0071456 GO:0098779 GO:0098792 GO:0098869
26	0.10	0.627	3.63	0.10	0.87	3qq2B	GO:0005576 GO:0007155 GO:0009279 GO:0009405 GO:0009986 GO:0016020 GO:0016021 GO:0019867 GO:0042597
27	0.10	0.557	3.15	0.07	0.73	2fljA	GO:0005215 GO:0005737 GO:0006810 GO:0008289
28	0.09	0.664	3.64	0.07	0.89	3sloA	GO:0004175 GO:0004252 GO:0005576 GO:0006508 GO:0008233 GO:0008236 GO:0009279 GO:0009405 GO:0009986 GO:0016020 GO:0016021 GO:0016787 GO:0019867 GO:0042597
29	0.08	0.665	3.39	0.06	0.87	3aehA	GO:0004175 GO:0004252 GO:0005576 GO:0006508 GO:0008233 GO:0008236 GO:0009279 GO:0009405 GO:0009986 GO:0016020 GO:0016021 GO:0016787 GO:0019867 GO:0042597
30	0.08	0.595	3.28	0.09	0.77	4a60A	GO:0001669 GO:0001675 GO:0005215 GO:0005737 GO:0005829 GO:0006810 GO:0008289 GO:0019433
31	0.08	0.581	3.02	0.14	0.74	1vyfA	GO:0005215 GO:0005737 GO:0006810 GO:0008289
32	0.07	0.586	3.15	0.09	0.76	3p6cA	GO:0001816 GO:0005215 GO:0005504 GO:0005634 GO:0005737 GO:0005811 GO:0005829 GO:0006469 GO:0006810 GO:0008289 GO:0019433 GO:0042632 GO:0045892 GO:0050727 GO:0050729 GO:0050872 GO:0050873 GO:0070062 GO:0071285
33	0.07	0.560	2.63	0.14	0.69	2ft9A	GO:0005215 GO:0005504 GO:0005737 GO:0006810 GO:0008289
34	0.07	0.567	2.68	0.10	0.70	1ealA	GO:0005215 GO:0005737 GO:0006810 GO:0006869 GO:0008206 GO:0008289 GO:0016020 GO:0032052
35	0.07	0.575	2.95	0.10	0.73	1kqwA	GO:0005215 GO:0006776 GO:0006810 GO:0008289 GO:0016918
36	0.07	0.555	2.86	0.12	0.70	2qo5A	GO:0005215 GO:0005504 GO:0005737 GO:0006810 GO:0008289 GO:0032052
37	0.07	0.553	3.43	0.09	0.74	4lktA	GO:0005215 GO:0005504 GO:0005654 GO:0005737 GO:0005829 GO:0006006 GO:0006629 GO:0006656 GO:0006810 GO:0008289 GO:0008544 GO:0009611 GO:0015758 GO:0019433 GO:0070062
38	0.07	0.554	3.23	0.08	0.73	1fdqA	GO:0001964 GO:0005215 GO:0005634 GO:0005654 GO:0005737 GO:0005829 GO:0005911 GO:0006810 GO:0007399 GO:0008285 GO:0008289 GO:0019433 GO:0021846 GO:0022008 GO:0042995 GO:0043025 GO:0044297 GO:0050673 GO:0060134 GO:0071944
39	0.07	0.666	3.52	0.06	0.88	4meeA	GO:0005576 GO:0007155 GO:0009279 GO:0009405 GO:0009986 GO:0016020 GO:0016021 GO:0019867 GO:0042597
40	0.07	0.572	3.04	0.12	0.73	2rcqA	GO:0001523 GO:0005215 GO:0005501 GO:0005737 GO:0005829 GO:0006776 GO:0006810 GO:0008289 GO:0008544 GO:0016918 GO:0019841
41	0.07	0.545	3.11	0.12	0.69	1p6pA	GO:0005215 GO:0005504 GO:0005737 GO:0006810 GO:0006869 GO:0008289
42	0.07	0.543	3.51	0.09	0.73	1cbiA	GO:0001972 GO:0005215 GO:0005501 GO:0005737 GO:0005829 GO:0006810 GO:0008289 GO:0016918 GO:0019841 GO:0034653
43	0.07	0.517	3.69	0.08	0.71	1mdcA	GO:0005215 GO:0005737 GO:0006810 GO:0008289
44	0.07	0.519	3.38	0.14	0.69	2mm3A	GO:0005215 GO:0005737 GO:0005829 GO:0006629 GO:0006810 GO:0006869 GO:0008206 GO:0008285 GO:0008289 GO:0015721 GO:0016020 GO:0019433 GO:0032052
45	0.07	0.478	3.98	0.08	0.71	2n93A	GO:0005215 GO:0006810 GO:0008289
46	0.07	0.496	3.54	0.08	0.70	1aelA	GO:0005215 GO:0005324 GO:0005504 GO:0005737 GO:0005886 GO:0005902 GO:0006631 GO:0006810 GO:0008289 GO:0015908 GO:0015909 GO:0045179 GO:0050892
47	0.07	0.401	4.86	0.04	0.67	4q2hA	GO:0016853 GO:0047580
48	0.06	0.370	5.08	0.06	0.63	4ohqB	GO:0003824 GO:0004807 GO:0005739 GO:0005829 GO:0006094 GO:0006096 GO:0006642 GO:0008152 GO:0009507 GO:0009536 GO:0009570 GO:0009579 GO:0009658 GO:0009941 GO:0016853 GO:0019253 GO:0019563 GO:0032504 GO:0046166 GO:0048046 GO:0080022
49	0.06	0.359	4.42	0.05	0.54	1l8kA	GO:0004721 GO:0004725 GO:0004726 GO:0005178 GO:0005634 GO:0005654 GO:0005737 GO:0005783 GO:0005793 GO:0005886 GO:0006470 GO:0008285 GO:0008286 GO:0010804 GO:0010888 GO:0016020 GO:0016311 GO:0016787 GO:0016791 GO:0019901 GO:0019905 GO:0030183 GO:0030217 GO:0030218 GO:0030971 GO:0035335 GO:0042059 GO:0042512 GO:0042518 GO:0042524 GO:0042527 GO:0042593 GO:0045650 GO:0045722 GO:0046627 GO:0050728 GO:0050860 GO:0050922 GO:0060334 GO:0060336 GO:0060339 GO:0061099 GO:0070104 GO:0070373 GO:1902202 GO:1902206 GO:1902212 GO:1902215 GO:1902227 GO:1902233 GO:1902237 GO:1903899 GO:2000587
50	0.06	0.364	5.29	0.06	0.64	3e74B	GO:0000256 GO:0004038 GO:0005737 GO:0006144 GO:0008270 GO:0009442 GO:0016787 GO:0016810 GO:0046872 GO:0050897
51	0.06	0.360	5.48	0.09	0.66	3opnA	GO:0003723 GO:0008168 GO:0032259
52	0.06	0.347	5.98	0.04	0.70	1wxrA	GO:0004175 GO:0004252 GO:0005576 GO:0006508 GO:0008233 GO:0008236 GO:0009279 GO:0009405 GO:0009986 GO:0016020 GO:0016021 GO:0016787 GO:0019867 GO:0042597
53	0.06	0.340	5.91	0.06	0.68	3ak5A	GO:0004175 GO:0004252 GO:0005576 GO:0006508 GO:0008233 GO:0008236 GO:0009279 GO:0009405 GO:0009986 GO:0016020 GO:0016021 GO:0016787 GO:0019867 GO:0042597

Consensus prediction of GO terms

Molecular Function	GO:0003677	GO:0046872	GO:0033293
GO-Score	0.41	0.41	0.40
Biological Processes	GO:0006810	GO:0033673	GO:0055092	GO:0001933	GO:0044707	GO:0071345	GO:1903507	GO:0010629	GO:0045859	GO:0006954	GO:0006355	GO:2000113	GO:0071248	GO:0031349	GO:0045444	GO:0034612	GO:0032103	GO:0010226
GO-Score	0.93	0.40	0.40	0.40	0.40	0.40	0.40	0.40	0.40	0.40	0.40	0.40	0.40	0.40	0.40	0.40	0.40	0.40
Cellular Component	GO:0005886	GO:0005829	GO:0031988	GO:1903561	GO:0031981
GO-Score	0.46	0.44	0.40	0.40	0.40

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.