I-TASSER results

Input Sequence in FASTA format

>protein (123 residues)
MTDRSREPADPWKGFSAVMAATLILEAIVVLLAIPVVDAVGGGLRPASLGYLVGLAVLLI
LLTGLQRRPWAIWVNLGAQPVLVAGFAVYPGVGFIGVLFAALWVLIAYLRAEVRRRRDYR
VSQ

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 \| \| \| \| \| \| MTDRSREPADPWKGFSAVMAATLILEAIVVLLAIPVVDAVGGGLRPASLGYLVGLAVLLILLTGLQRRPWAIWVNLGAQPVLVAGFAVYPGVGFIGVLFAALWVLIAYLRAEVRRRRDYRVSQ
Prediction	CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Conf.Score	999899999985566678999999999999999999887479865568999999999999999975985578899999999999999999999999999999999999977789998765579
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 \| \| \| \| \| \| MTDRSREPADPWKGFSAVMAATLILEAIVVLLAIPVVDAVGGGLRPASLGYLVGLAVLLILLTGLQRRPWAIWVNLGAQPVLVAGFAVYPGVGFIGVLFAALWVLIAYLRAEVRRRRDYRVSQ
Prediction	856666546322422312112223313333332322133024433333333121221211221232434312311232133233233333333331232232132012124305544743578
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120

                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
MTDRSREPADPWKGFSAVMAATLILEAIVVLLAIPVVDAVGGGLRPASLGYLVGLAVLLILLTGLQRRPWAIWVNLGAQPVLVAGFAVYPGVGFIGVLFAALWVLIAYLRAEVRRRRDYRVSQ

2vpyC2

0.21

0.16

0.78

1.04

wPPAS

------NLNRPL---NGLMAGLFPLTALVLALGLAALLK--SPWALFPLRVLAGASLLLALLYPLT--P-PEARGHLLEEA----GFWYGLFLLLGLGF---W------QERLAPWAGLLAAA

2x2vA

0.15

0.08

0.55

1.23

dPPAS2

-----------------------------AFLGAAIAAGL-----AAVAGAIAVAIIVKATIEGTTRQ---PELRGTLQTLMFIGVPLAEAVPIIAIVISLLILF------------------

5ezmA3

0.16

0.13

0.79

1.03

PPAS

-----------SPRSWGKQLIGMAIVAACGLLASPVVATLNANHIPNSFYRAYAVWVAVAFVVMLL---GIAVARLLLRR-----------VLPSVAVYAMGMYLGFTVALLGHETVGRPAS-

5doqA3

0.18

0.15

0.84

1.00

wPPAS

MNG------DPVLLSRILTELTLTVHIIYATIGVGVPLMI-----VITVAVGVVTGTAIGLQLSLL---WPNFMQLWI-MKTAEGAHVDTMLVLFCLLYIVLVIASATVLIRMFRRN---P--

2mawA

0.10

0.09

0.89

1.10

dPPAS2

-------------EEELYYGLNLLIPCVLISALALLVFLLPADSGSLGITVLLSLTVFMLLVAEIMPSPSIAQYFASTMIIVGLSVVVTVIVLQYGIDRLCLMAFSVFTIICTIGILMSAPNF

4cofA2

0.12

0.11

0.89

1.00

PPAS

--------------IGYFILQTYMPSILITILSWVSFWNYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFSQPARAAAIDRWSRIVFPFT

2ksfA

0.23

0.17

0.76

0.99

wPPAS

MVQ--------IQG----SVVAAALSAVITLIAMQWLMAFDAA---------VMLYLLGVVVVALFGRWPSV-VATVINVVSFDLFFI-VQYLLTFAVMLTVGLVIGNLTAGVRY-------Q

5ezmA3

0.17

0.12

0.70

1.10

dPPAS2

-----------SPRSWGKQLIGMAIVAACGLLASPVVATLNANHIAVWVAVAFVVMLLGIAVARLLLRPSVAVYAMGMYLGFTVALLGHETVGRPAS--------------------------

4xydA1

0.14

0.12

0.89

0.97

wPPAS

MK--------Q-SIALVYFAVALGLFAIQVSGGLLLGWIYVSPNFLIVWLLLGFMGAAYFVIPEESERELAYLQLAIMVLGTLGVVVTYLFVWVKMGIVVAALIFMYNISMTVLQGR-----K

4cofA2

0.10

0.09

0.88

1.10

dPPAS2

---------------IGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLREPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFSQPARAAAIDRWSRIVFPFT

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-3.15

Estimated TM-score = 0.36±0.12

Estimated RMSD = 11.5±4.5Å

Download Model 2

C-score=-3.76

Download Model 3

C-score=-4.17

Download Model 4

C-score=-4.00

Download Model 5

C-score=-4.26

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	2mawA	0.721	2.23	0.073	0.886
2	4uosA	0.704	2.93	0.058	0.959
3	2bg9E	0.701	3.10	0.116	0.984
4	2bg9B	0.696	3.15	0.100	0.976
5	3jacA2	0.693	3.08	0.102	0.951
6	2ksrA	0.683	2.70	0.082	0.894
7	2j69A	0.679	3.53	0.041	0.959
8	2bg9A	0.678	3.22	0.132	0.984
9	4cofA	0.672	2.99	0.086	0.935
10	3rhwA	0.671	2.92	0.070	0.927

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.12	7	3rqgC	III	Rep, Mult	49,53,56,59,60,63,76,79,80,83,87
2	0.05	3	4tt0A	IOD	Rep, Mult	26,29
3	0.05	3	1watB	ASP	Rep, Mult	89,98,99,101
4	0.05	3	4xnjA	78M	Rep, Mult	32,36,39,95,99
5	0.04	2	3u3cA	III	Rep, Mult	21,24,25,28,113
6	0.03	2	1ow8A	III	Rep, Mult	25,29,35,36,39,99,102,106,109
7	0.03	2	3rifB	IVM	Rep, Mult	30,31,34,35,38
8	0.02	1	3k2sA	CLR	Rep, Mult	89,101,104,105
9	0.02	1	2r9rB	PGW	Rep, Mult	106,121
10	0.02	1	2ljcB	RIM	Rep, Mult	18,21
11	0.02	1	2xqtE	CVM	Rep, Mult	89,92
12	0.02	1	2rh1A	CLR	Rep, Mult	34,55
13	0.02	1	1q90G	BCR	Rep, Mult	81,84,85,88
14	0.02	1	2w6dB	CPL	Rep, Mult	63,65,74,75,77
15	0.02	1	5buoA	ZN	Rep, Mult	26,54

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.240	3eziA	0.600	2.83	0.117	0.813	2.7.13.3	77,79,107,113
2	0.147	1c17M	0.654	3.45	0.042	0.943	3.6.3.14	NA
3	0.122	2npuA	0.513	3.50	0.083	0.780	2.7.11.1	31,55,75
4	0.120	3kkbB	0.602	2.29	0.070	0.699	2.7.13.3	NA
5	0.066	2e2aA	0.505	3.00	0.069	0.667	2.7.1.69	NA
6	0.060	1fpsA	0.615	3.66	0.090	0.911	2.5.1.1,2.5.1.10	NA
7	0.060	2e76A	0.564	4.28	0.085	0.927	1.10.99.1	23,61
8	0.060	1hxgA	0.591	3.58	0.075	0.846	4.2.3.9,4.1.99.7	89
9	0.060	3g61A	0.639	3.64	0.074	0.911	3.6.3.44	NA
10	0.060	2c6fA	0.553	3.85	0.054	0.821	3.4.15.1	NA
11	0.060	3gehA	0.643	3.51	0.116	0.959	3.6.-.-	NA
12	0.060	1xzpA	0.635	3.55	0.091	0.959	3.6.5.-	92
13	0.060	1q0mD	0.532	3.39	0.100	0.764	1.15.1.1	61,107
14	0.060	2qb0B	0.324	4.32	0.066	0.496	3.2.1.17	NA
15	0.060	1v4eA	0.567	3.86	0.067	0.862	2.5.1.11	NA
16	0.060	2ksfA	0.588	3.17	0.118	0.829	2.7.13.3	52,74,86,98,101
17	0.060	2cdqA	0.560	4.08	0.102	0.862	2.7.2.4	31,79
18	0.060	1wmwA	0.577	3.62	0.117	0.829	2.5.1.-	NA
19	0.060	2q80A	0.577	3.71	0.075	0.846	2.5.1.29,2.5.1.10,2.5.1.1	51,93,102
20	0.060	2r25A	0.582	3.46	0.074	0.862	2.7.13.3	58,79
21	0.060	2dh4A	0.589	3.72	0.066	0.878	2.5.1.29	NA
22	0.060	1tqgA	0.562	3.10	0.081	0.797	2.7.13.3	NA
23	0.060	1jtnA	0.324	4.35	0.066	0.504	3.2.1.17	26
24	0.060	3lliA	0.560	3.16	0.103	0.797	1.8.3.2	52,71,101

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.26	0.655	3.27	0.18	0.95	4pirC	GO:0004889 GO:0004993 GO:0005230 GO:0005232 GO:0005886 GO:0005892 GO:0006810 GO:0006811 GO:0007210 GO:0007271 GO:0015276 GO:0015464 GO:0016020 GO:0016021 GO:0022850 GO:0030054 GO:0034220 GO:0042166 GO:0045202 GO:0045211 GO:0051378 GO:0098655 GO:1904602
1	0.25	0.680	2.58	0.13	0.90	1oedE	GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0045202 GO:0045211 GO:0098655
2	0.24	0.683	2.70	0.08	0.89	2ksrA	GO:0001508 GO:0001661 GO:0001666 GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0005892 GO:0006810 GO:0006811 GO:0006816 GO:0006939 GO:0007165 GO:0007271 GO:0007274 GO:0007601 GO:0007605 GO:0007612 GO:0007613 GO:0007626 GO:0008144 GO:0008306 GO:0008542 GO:0009897 GO:0014059 GO:0015276 GO:0015464 GO:0016020 GO:0016021 GO:0019233 GO:0021562 GO:0021631 GO:0021771 GO:0021952 GO:0021955 GO:0030054 GO:0030890 GO:0032225 GO:0032226 GO:0033603 GO:0035094 GO:0035095 GO:0035176 GO:0042053 GO:0042113 GO:0042166 GO:0042220 GO:0042320 GO:0042391 GO:0045188 GO:0045202 GO:0045211 GO:0045471 GO:0045759 GO:0046982 GO:0048814 GO:0050877 GO:0050890 GO:0051291 GO:0051899 GO:0051963 GO:0060084 GO:0098655 GO:0099565
3	0.24	0.694	3.18	0.11	0.98	4aq5E	GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0045202 GO:0045211 GO:0098655
4	0.24	0.721	2.23	0.07	0.89	2mawA	GO:0000187 GO:0001540 GO:0001666 GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0005892 GO:0006810 GO:0006811 GO:0006816 GO:0006874 GO:0007165 GO:0007271 GO:0007613 GO:0008284 GO:0015276 GO:0015464 GO:0015643 GO:0016020 GO:0016021 GO:0017081 GO:0022848 GO:0030054 GO:0032720 GO:0034220 GO:0035094 GO:0042166 GO:0042803 GO:0045202 GO:0045211 GO:0045766 GO:0050890 GO:0098655 GO:0099565
5	0.23	0.673	2.99	0.06	0.89	2lm2A	GO:0001508 GO:0001661 GO:0001666 GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0005892 GO:0006810 GO:0006811 GO:0006816 GO:0006939 GO:0007165 GO:0007271 GO:0007274 GO:0007601 GO:0007605 GO:0007612 GO:0007613 GO:0007626 GO:0008144 GO:0008306 GO:0008542 GO:0009897 GO:0014059 GO:0015276 GO:0015464 GO:0016020 GO:0016021 GO:0019233 GO:0021562 GO:0021631 GO:0021771 GO:0021952 GO:0021955 GO:0030054 GO:0030890 GO:0032225 GO:0032226 GO:0033603 GO:0035094 GO:0035095 GO:0035176 GO:0042053 GO:0042113 GO:0042166 GO:0042220 GO:0042320 GO:0042391 GO:0045188 GO:0045202 GO:0045211 GO:0045471 GO:0045759 GO:0046982 GO:0048814 GO:0050877 GO:0050890 GO:0051291 GO:0051899 GO:0051963 GO:0060084 GO:0098655 GO:0099565
6	0.22	0.671	3.18	0.15	0.97	4aq5A	GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0045202 GO:0045211 GO:0098655
7	0.21	0.682	2.58	0.14	0.89	1oedB	GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0045202 GO:0045211 GO:0098655
8	0.19	0.625	2.94	0.11	0.89	1oedC	GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0045202 GO:0045211 GO:0098655
9	0.18	0.664	2.72	0.14	0.89	1oedA	GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0045202 GO:0045211 GO:0098655
10	0.17	0.620	2.93	0.09	0.85	2llyA	GO:0001508 GO:0001666 GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0005892 GO:0006281 GO:0006810 GO:0006811 GO:0006816 GO:0006979 GO:0007165 GO:0007268 GO:0007271 GO:0007274 GO:0007585 GO:0007626 GO:0009897 GO:0014059 GO:0015276 GO:0015464 GO:0016020 GO:0016021 GO:0019233 GO:0030054 GO:0030425 GO:0034220 GO:0035094 GO:0035095 GO:0035640 GO:0042113 GO:0042166 GO:0042391 GO:0043025 GO:0045202 GO:0045211 GO:0050877 GO:0050890 GO:0051899 GO:0060080 GO:0098655
11	0.11	0.696	3.13	0.12	0.98	4aq5B	GO:0004889 GO:0005216 GO:0005230 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0045202 GO:0045211 GO:0098655
12	0.10	0.687	2.94	0.09	0.95	3jafA	GO:0005230 GO:0005254 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0006821 GO:0007218 GO:0007417 GO:0008270 GO:0016020 GO:0016021 GO:0016594 GO:0016934 GO:0022824 GO:0030054 GO:0030425 GO:0034220 GO:0034707 GO:0042995 GO:0043200 GO:0043204 GO:0045202 GO:0045211 GO:0045664 GO:0046872 GO:0051260 GO:0060012 GO:0071230 GO:0071294 GO:0071361 GO:0099565 GO:1902476
13	0.09	0.657	3.12	0.07	0.94	4tnwA	GO:0005230 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0008068 GO:0016020 GO:0016021 GO:0016595 GO:0030054 GO:0031987 GO:0045202 GO:0045211 GO:0051259 GO:1902476
14	0.09	0.672	2.99	0.09	0.94	4cofA	GO:0004890 GO:0005216 GO:0005230 GO:0005254 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0006821 GO:0007165 GO:0007605 GO:0016020 GO:0016021 GO:0022851 GO:0030054 GO:0034220 GO:0034707 GO:0043523 GO:0043524 GO:0045202 GO:0045211 GO:0048666 GO:0060021 GO:0060080 GO:0060119 GO:0060384 GO:0071420 GO:0090102 GO:1901215 GO:1902476 GO:1902711
15	0.08	0.613	3.45	0.07	0.94	4ireB	GO:0005230 GO:0005267 GO:0005272 GO:0005886 GO:0006810 GO:0006811 GO:0006813 GO:0006814 GO:0016020 GO:0016021 GO:0035725 GO:0071805
16	0.07	0.627	3.16	0.06	0.89	4z90A	GO:0005230 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0034220
17	0.07	0.588	3.67	0.09	0.94	4yeuA	GO:0005230 GO:0005267 GO:0005272 GO:0005886 GO:0006810 GO:0006811 GO:0006813 GO:0006814 GO:0016020 GO:0016021 GO:0034220 GO:0035725 GO:0071805
18	0.07	0.603	3.11	0.06	0.88	4x5tA	GO:0001508 GO:0001964 GO:0002087 GO:0005230 GO:0005254 GO:0005267 GO:0005272 GO:0005622 GO:0005783 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0006813 GO:0006814 GO:0006820 GO:0006821 GO:0006936 GO:0007218 GO:0007268 GO:0007340 GO:0007601 GO:0007628 GO:0008270 GO:0009897 GO:0016020 GO:0016021 GO:0016594 GO:0016933 GO:0016934 GO:0022824 GO:0030054 GO:0030425 GO:0030977 GO:0034220 GO:0034707 GO:0035725 GO:0042391 GO:0042995 GO:0043005 GO:0043025 GO:0043204 GO:0043231 GO:0043576 GO:0045202 GO:0045211 GO:0046872 GO:0050884 GO:0050905 GO:0051260 GO:0051291 GO:0051970 GO:0060012 GO:0060013 GO:0060077 GO:0060080 GO:0071230 GO:0071294 GO:0071361 GO:0071805 GO:0097305 GO:1902476 GO:2000344

Consensus prediction of GO terms

Molecular Function	GO:0004889	GO:0042166	GO:0015464	GO:0008227	GO:0043176	GO:0099589	GO:0022824	GO:1901363	GO:0097159	GO:0046983	GO:0016247	GO:0042802	GO:0042277
GO-Score	0.76	0.57	0.57	0.52	0.52	0.52	0.52	0.49	0.49	0.48	0.48	0.48	0.48
Biological Processes	GO:0098655	GO:0007271	GO:0007186	GO:0051703	GO:0042747	GO:0042748	GO:0050807	GO:0050871	GO:0030534	GO:0021794	GO:0050773	GO:0051705	GO:0001963	GO:0098900	GO:0007632	GO:0008306	GO:0050806	GO:0097305	GO:0021955	GO:0042069	GO:0060073	GO:0048813	GO:0042417	GO:0050953	GO:0051259	GO:0010769	GO:0050671	GO:0050954	GO:0006936	GO:0007416	GO:0021602	GO:0014059	GO:0021554	GO:0033605	GO:0044087	GO:0045187	GO:0030888	GO:0048857	GO:0007631	GO:1904018	GO:0055074	GO:0043406	GO:0072503	GO:0045765	GO:1903556	GO:0006875	GO:0032680	GO:0032147	GO:0007613	GO:0006816	GO:0035094	GO:0099565	GO:0001666
GO-Score	0.76	0.57	0.52	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.48	0.42	0.42	0.42	0.42	0.42
Cellular Component	GO:0030054	GO:0045211	GO:0005892	GO:0034703	GO:0009986	GO:0098552
GO-Score	0.76	0.76	0.57	0.52	0.48	0.48

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv2446c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]