I-TASSER results

Input Sequence in FASTA format

>protein (189 residues)
MLSMSNDRADTGGRILRAAASCVVDYGVDRVTLAEIARRAGVSRPTVYRRWPDTRSIMAS
MLTSHIADVLREVPLDGDDREALVKQIVAVADRLRGDDLIMSVMHSELARVYITERLGTS
QQVLIEGLAARLTVAQRSGSVRSGDARRLATMVLLIAQSTIQSADIVDSILDSAALATEL
THALNGYLC

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 180 \| \| \| \| \| \| \| \| \| MLSMSNDRADTGGRILRAAASCVVDYGVDRVTLAEIARRAGVSRPTVYRRWPDTRSIMASMLTSHIADVLREVPLDGDDREALVKQIVAVADRLRGDDLIMSVMHSELARVYITERLGTSQQVLIEGLAARLTVAQRSGSVRSGDARRLATMVLLIAQSTIQSADIVDSILDSAALATELTHALNGYLC
Prediction	CCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCC
Conf.Score	999887769999999999999999989766999999999899888888878999999999999999999998556899799999999999999985989999999865587688888899999999999999999998999998999999999999999998555678899999999999999999759
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 180 \| \| \| \| \| \| \| \| \| MLSMSNDRADTGGRILRAAASCVVDYGVDRVTLAEIARRAGVSRPTVYRRWPDTRSIMASMLTSHIADVLREVPLDGDDREALVKQIVAVADRLRGDDLIMSVMHSELARVYITERLGTSQQVLIEGLAARLTVAQRSGSVRSGDARRLATMVLLIAQSTIQSADIVDSILDSAALATELTHALNGYLC
Prediction	765456656522420140024002532145031530053161343000321441430022003320451154047645224201300220032025341022003442334413531451243014102403530364352356213200200132011101213225462435303502330452217
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160                 180

                   |                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCC
MLSMSNDRADTGGRILRAAASCVVDYGVDRVTLAEIARRAGVSRPTVYRRWPDTRSIMASMLTSHIADVLREVPLDGDDREALVKQIVAVADRLRGDDLIMSVMHSELARVYITERLGTSQQVLIEGLAARLTVAQRSGSVRSGDARRLATMVLLIAQSTIQSADIVDSILDSAALATELTHALNGYLC

2f07A

0.18

1.00

1.97

MUSTER

PFTMPKQTSGKYEKILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAENLLTHTLDQIKGDEDFWTVLDILIDETFLITERHKDIIVLCYSGLAIDHSMEKWETIYQPYYSWLEKIINKAIANHEVTEGNSKWTARTIINLVENTAERFYIGFEQENVEVYKKEIFTFLKRSLG

2nx4A

0.15

0.99

1.71

dPPAS

GVPKLVDHDERRRSITAAAWRLIAARGIEAANMRDIATEAGYTNGALSHYFAGKDEILRTSYEHISEATDRRIAGDATGLDALRILCREVEEQLLEARIAASLWPRAMYDEQMAATNRRTMDNWREQMAIFLEQAREEGSVGDIDVTIVVEQLLNMMMGMQILGVLTPGETSSERQLEMLEQFVAAL--

2f07A

0.17

1.00

2.04

wdPPAS

PFTMPKQTSGKYEKILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAENLLTHTLDQIKGDEDFWTVLDILIDETFLITERHKDIIVLCYSGLAIDHSMEKWETIYQPYYSWLEKIINKAIANHEVTEGNSKWTARTIINLVENTAERFYGFEQDENVEVYKKEIFTFLKRSLG

2f07A

0.18

0.98

2.28

wMUSTER

M---PKQTSGKYEKILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAENLLTHTLDQIKGDEDFWTVLDILIDETFLITERHKDIIVLCYSGLAIDHSMEKWETIYQPYYSWLEKIINKAIANHEVTEGNSKWTARTIINLVENTAERFYIFEQDENVEVYKKEIFTFLKRSLG

2f07A

0.17

1.00

2.43

wPPAS

PFTMPKQTSGKYEKILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAENLLTHTLDQIKGDEDFWTVLDILIDETFLITERHKDIIVLCYSGLAIDHSMEKWETIYQPYYSWLEKIINKAIANHEVTEGNSKWTARTIINLVENTAERFYGFEQDENVEVYKKEIFTFLKRSLA

2f07A

0.17

1.00

2.17

dPPAS2

PFTMPKQTSGKYEKILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAENLLTHTLDQIKGDEDFWTVLDILIDETFLITERHKDIIVLCYSGLAIDHSMEKWETIYQPYYSWLEKIINKAIANHEVTEGNSKWTARTIINLVENTAERFYGFEQDENVEVYKKEIFTFLKRSLG

2f07A

0.17

1.00

2.24

PPAS

PFTMPKQTSGKYEKILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAENLLTHTLDQIKGDEDFWTVLDILIDETFLITERHKDIIVLCYSGLAIDHSMEKWETIYQPYYSWLEKIINKAIANHEVTEGNSKWTARTIINLVENTAERFYGFEQDENVEVYKKEIFTFLKRSLG

4w97A

0.12

0.99

2.85

Env-PPAS

--RVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQSQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGIT

2nx4A

0.15

0.98

1.90

MUSTER

V-PKLVDHDERRRSITAAAWRLIAARGIEAANMRDIATEAGYTNGALSHYFAGKDEILRTSYEHISEATDRRIAGDATGLDALRILCREVMPINEEQLLEARIAASLWPDEQMAATNRRTMDNWREQMAIFLEQAREEGSVGDIDVTIVVEQLLNMMMGMQILGVLTPGETSSERQLEMLEQFVAAL--

2f07A

0.17

1.00

1.71

dPPAS

PFTMPKQTSGKYEKILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAENLLTHTLDQIKGDEDFWTVLDILIDETFLITERHKDIIVLCYSGLAIDHSMEKWETIYQPYYSWLEKIINKAIANHEVTEGNSKWTARTIINLVENTAERFYGFEQDENVEVYKKEIFTFLKRSLG

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 4 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=0.48

Estimated TM-score = 0.78±0.10

Estimated RMSD = 4.3±2.8Å

Download Model 2

C-score=-2.35

Download Model 3

C-score=-5.00

Download Model 4

C-score=-4.55

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	2f07A	0.953	1.18	0.175	1.000
2	2id3A	0.788	2.57	0.230	0.942
3	3on2A	0.773	2.52	0.144	0.915
4	1rktA	0.771	3.06	0.172	0.979
5	5d1rA	0.771	2.94	0.165	0.963
6	2hytA	0.770	2.65	0.176	0.926
7	3crjA	0.767	2.86	0.139	0.952
8	3e7qB	0.762	2.92	0.128	0.963
9	3bhqA	0.762	3.05	0.155	0.958
10	5d18A	0.760	2.92	0.123	0.942

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.12	34	3br5A	RHQ	Rep, Mult	62,65,66,69,72,93,94,97,101,120,124,161
2	0.10	30	4dw6A	0MN	Rep, Mult	73,82,83,86,87,90,94,117,121,127,128,131,154,157,158,161,162,184
3	0.10	28	3btcA	MGR	Rep, Mult	69,94,97,108,121,124,125,154,155,158
4	0.05	12	1jt0C	QNA	Rep, Mult	11,42,43,44,45,46,49,50
5	0.04	11	3angD	DCC	Rep, Mult	68,90,104,114,115,118,121,145,148,151,154,155,158
6	0.04	8	1jt0A	QNA	Rep, Mult	32,33,44,48,53,54
7	0.04	11	3q3sA	O8B	Rep, Mult	73,83,86,87,90,94,101,105,117,121,124,127,128,154,157,158,161,162,165,184
8	0.02	7	1vi0B	DCC	Rep, Mult	159,162,163,166,167,170,171
9	0.02	7	3whcA	ST9	Rep, Mult	61,62,65,66,69,90,93,97,100,101,105,114,117,118,121,122,125,147,150,154
10	0.02	6	2dg80	III	Rep, Mult	23,24,27,29,98,99,102,103,105,106,108,109,110,114,117,118,121,149,152,154,155,158,159,160,163,165,166,168,179,182,183,186
11	0.01	2	3lsjA	COA	Rep, Mult	79,82,137,188,189
12	0.01	2	3lsrA	QNA	Rep, Mult	32,33,34,38,44,45,48
13	0.01	3	2dtz0	III	Rep, Mult	101,102,105,106,108,121,145,152,155,156,158,159,162,163,164,176,179,180,183,184,186,187
14	0.01	3	2i10B	NPO	Rep, Mult	121,122,151
15	0.01	3	3p9tA	TCL	Rep, Mult	66,69,87,105,120,121,124,128,153,154,157
16	0.01	2	3lsjA	COA	Rep, Mult	83,86,184,185,188
17	0.00	1	2eh3A	MG	Rep, Mult	85,88
18	0.00	1	3angB	DCC	Rep, Mult	163,167,171,172,175,179
19	0.00	1	3locA	URA	Rep, Mult	163
20	0.00	1	1bjyA	CTC	Rep, Mult	180,184

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	2b4kA	0.457	6.20	0.061	0.910	3.1.1.43	NA
2	0.060	1mpxA	0.448	6.29	0.038	0.889	3.2.1.43	NA
3	0.060	2e8yA	0.459	5.08	0.077	0.762	3.2.1.41	14,53
4	0.060	1uokA	0.452	4.66	0.060	0.704	3.2.1.10	NA
5	0.060	1s6yA	0.446	5.14	0.049	0.725	3.2.1.86	NA
6	0.060	3jvpD	0.452	5.32	0.051	0.772	2.7.1.16	NA
7	0.060	2zf5Y	0.450	5.61	0.057	0.799	2.7.1.30	18
8	0.060	1bxnE	0.456	4.60	0.063	0.672	4.1.1.39	17
9	0.060	3c46B	0.405	6.15	0.048	0.757	2.7.7.6	NA
10	0.060	1gowA	0.453	5.26	0.037	0.772	3.2.1.23	NA
11	0.060	2ze0A	0.448	4.67	0.074	0.709	3.2.1.20	NA
12	0.060	1rblA	0.460	4.37	0.079	0.661	4.1.1.39	NA
13	0.060	1gk8A	0.460	4.43	0.047	0.661	4.1.1.39	NA
14	0.060	2wanA	0.446	5.18	0.041	0.757	3.2.1.41	32
15	0.060	2cerA	0.446	4.99	0.044	0.746	3.2.1.23	54
16	0.060	2d0tB	0.474	5.22	0.047	0.804	1.13.11.52	34
17	0.060	2fhcA	0.407	5.45	0.056	0.714	3.2.1.41	20
18	0.060	2z8yD	0.412	5.57	0.080	0.720	1.2.7.4,1.2.99.2	22,59,63,103
19	0.060	2a4zA	0.447	4.65	0.076	0.709	2.7.1.153	29

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.44	0.728	2.86	0.18	0.92	2np5A	GO:0003677 GO:0006351 GO:0006355
1	0.44	0.953	1.18	0.17	1.00	2f07A	GO:0003677 GO:0006351 GO:0006355
2	0.40	0.786	3.04	0.17	0.99	1rktA	GO:0003677 GO:0006351 GO:0006355
3	0.39	0.738	2.67	0.20	0.90	3vuqC	GO:0003677 GO:0006351 GO:0006355
4	0.38	0.686	3.37	0.11	0.92	3ppbA	GO:0003677 GO:0006351 GO:0006355
5	0.36	0.774	2.74	0.17	0.94	3whcA	GO:0003677 GO:0005737 GO:0006351 GO:0006355 GO:0006629 GO:0006631 GO:0016042
6	0.35	0.788	2.60	0.17	0.94	3on2B	GO:0003677 GO:0006351 GO:0006355
7	0.33	0.661	3.56	0.11	0.88	3f1bA	GO:0003677 GO:0006351 GO:0006355
8	0.32	0.675	3.47	0.11	0.91	3pasB	GO:0003677 GO:0006351 GO:0006355
9	0.32	0.717	3.30	0.17	0.95	4l62A	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355
10	0.31	0.714	3.18	0.16	0.93	3dcfA	GO:0003677 GO:0006351 GO:0006355
11	0.31	0.720	3.15	0.15	0.95	3vibC	GO:0003677 GO:0006351 GO:0006355
12	0.30	0.627	3.26	0.20	0.83	2qwtA	GO:0003677 GO:0006351 GO:0006355
13	0.30	0.719	3.15	0.11	0.93	1jt0A	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0045892
14	0.29	0.724	3.13	0.17	0.95	2genA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
15	0.29	0.733	3.17	0.19	0.96	5f1jA	GO:0003677 GO:0006351 GO:0006355
16	0.28	0.703	3.34	0.16	0.93	2fq4A	GO:0003677 GO:0006351 GO:0006355
17	0.27	0.650	3.77	0.18	0.90	2oerB	GO:0003677 GO:0006351 GO:0006355
18	0.27	0.688	3.71	0.20	0.93	4cgrA	GO:0003677 GO:0006351 GO:0006355
19	0.27	0.758	2.96	0.18	0.97	4ichA	GO:0003677 GO:0006351 GO:0006355
20	0.27	0.636	3.58	0.13	0.85	3ccyA	GO:0003677 GO:0006351 GO:0006355
21	0.27	0.697	3.43	0.16	0.93	5d1wD	GO:0003677 GO:0006351 GO:0006355
22	0.27	0.718	3.12	0.12	0.94	3he0C	GO:0003677 GO:0006351 GO:0006355
23	0.26	0.705	3.38	0.13	0.94	2rasB	GO:0003677 GO:0006351 GO:0006355
24	0.26	0.635	3.89	0.12	0.94	3nnrA	GO:0003677 GO:0006351 GO:0006355
25	0.26	0.755	2.66	0.12	0.92	3lwjA	GO:0003677 GO:0006351 GO:0006355
26	0.25	0.644	3.83	0.11	0.90	3s5rA	GO:0003677 GO:0006351 GO:0006355
27	0.25	0.758	3.08	0.15	0.96	3angC	GO:0003677 GO:0006351 GO:0006355
28	0.25	0.762	2.92	0.13	0.96	3e7qB	GO:0003677 GO:0003700 GO:0006351 GO:0006355
29	0.24	0.744	2.22	0.15	0.87	2dg8B	GO:0003677 GO:0006351 GO:0006355
30	0.24	0.750	3.23	0.12	0.96	3hggA	GO:0003677 GO:0006351 GO:0006355
31	0.24	0.720	3.03	0.12	0.90	3cjdA	GO:0003677 GO:0006351 GO:0006355
32	0.24	0.609	4.02	0.14	0.84	3vvxA	GO:0003677 GO:0006351 GO:0006355
33	0.24	0.738	3.20	0.14	0.95	3f0cA	GO:0003677 GO:0006351 GO:0006355
34	0.23	0.692	3.05	0.19	0.90	4jl3C	GO:0003677 GO:0006351 GO:0006355
35	0.23	0.741	2.90	0.15	0.94	4yzeA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0045892
36	0.23	0.718	3.00	0.14	0.90	2y31A	GO:0003677 GO:0006351 GO:0006355 GO:0045892
37	0.23	0.609	4.02	0.20	0.88	2q24B	GO:0003677 GO:0006351 GO:0006355
38	0.22	0.666	3.17	0.08	0.85	4w97A	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0010468 GO:0019217
39	0.22	0.681	3.66	0.15	0.94	3bjbB	GO:0003677 GO:0006351 GO:0006355
40	0.22	0.649	3.77	0.11	0.90	3on4A	GO:0003677 GO:0006351 GO:0006355
41	0.22	0.669	3.08	0.13	0.86	4auxA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677 GO:0046872
42	0.22	0.634	3.50	0.11	0.83	2ibdA	GO:0003677 GO:0006351 GO:0006355
43	0.22	0.782	2.96	0.15	0.98	3bhqA	GO:0003677 GO:0006351 GO:0006355
44	0.22	0.714	3.43	0.17	0.95	3cwrA	GO:0003677 GO:0006351 GO:0006355
45	0.22	0.622	3.54	0.12	0.84	3colA	GO:0003677 GO:0006351 GO:0006355
46	0.21	0.700	3.80	0.12	0.94	2pbxA
47	0.21	0.655	3.76	0.14	0.90	4mxmA	GO:0003677 GO:0006351 GO:0006355
48	0.21	0.669	3.71	0.12	0.93	2id6A	GO:0003677 GO:0006351 GO:0006355
49	0.21	0.668	3.39	0.17	0.89	3cdlB	GO:0003677 GO:0006351 GO:0006355
50	0.21	0.665	3.53	0.13	0.90	2zcnD	GO:0003677 GO:0006351 GO:0006355
51	0.21	0.727	2.67	0.15	0.88	3htaA	GO:0003677 GO:0006351 GO:0006355
52	0.21	0.682	3.49	0.12	0.92	3qkxA	GO:0003677 GO:0006351 GO:0006355
53	0.20	0.667	3.76	0.10	0.91	3mvpA	GO:0003677 GO:0006351 GO:0006355
54	0.19	0.668	3.12	0.18	0.87	2pz9A	GO:0003677 GO:0003700 GO:0006351 GO:0006355
55	0.19	0.660	3.45	0.14	0.89	3zqgA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677 GO:0046872
56	0.19	0.681	3.51	0.14	0.89	3b81A	GO:0003677 GO:0006351 GO:0006355
57	0.18	0.673	3.30	0.18	0.88	3bqyA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677
58	0.18	0.672	3.89	0.10	0.92	3kz9B	GO:0003677 GO:0006351 GO:0006355
59	0.18	0.694	3.32	0.08	0.88	3vp5A	GO:0003677 GO:0006351 GO:0006355 GO:0046872
60	0.18	0.632	3.56	0.09	0.84	4me9A	GO:0003677 GO:0006351 GO:0006355
61	0.18	0.621	4.17	0.17	0.95	3rh2A	GO:0003677 GO:0006351 GO:0006355
62	0.18	0.591	4.12	0.10	0.85	2g7lA	GO:0003677 GO:0006351 GO:0006355 GO:0045892
63	0.17	0.657	3.23	0.16	0.85	3zqfA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677 GO:0046872
64	0.17	0.697	3.23	0.15	0.91	3aqtB	GO:0003677 GO:0006351 GO:0006355
65	0.17	0.666	3.10	0.11	0.87	2eh3A	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0046872
66	0.16	0.631	3.97	0.10	0.90	2qtqA	GO:0003677 GO:0006351 GO:0006355
67	0.14	0.731	3.32	0.17	0.98	2nx4A	GO:0003677 GO:0006351 GO:0006355
68	0.14	0.649	4.35	0.07	0.92	3nrgA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
69	0.14	0.650	3.69	0.13	0.91	3geuA	GO:0003677 GO:0006351 GO:0006355
70	0.14	0.703	3.33	0.10	0.94	3g7rB	GO:0003677 GO:0003700 GO:0006351 GO:0006355
71	0.13	0.641	3.75	0.08	0.91	4mk6A	GO:0003677 GO:0006351 GO:0006355
72	0.12	0.684	3.37	0.16	0.92	3knwA	GO:0003677 GO:0006351 GO:0006355
73	0.12	0.700	3.39	0.12	0.90	1sgmA	GO:0003677 GO:0006351 GO:0006355
74	0.12	0.677	3.76	0.14	0.94	2g7sA	GO:0003677 GO:0006351 GO:0006355
75	0.11	0.667	3.21	0.08	0.88	2qkoB	GO:0003677 GO:0006351 GO:0006355
76	0.11	0.699	3.36	0.14	0.93	2zcxA	GO:0003677 GO:0006351 GO:0006355
77	0.11	0.696	3.49	0.13	0.94	3bruA	GO:0003677 GO:0006351 GO:0006355
78	0.10	0.662	3.67	0.08	0.91	2iu5A	GO:0003677 GO:0006351 GO:0006355
79	0.10	0.561	4.73	0.11	0.89	3gziA	GO:0003677 GO:0006351 GO:0006355
80	0.10	0.752	3.24	0.15	0.95	3c07A	GO:0003677 GO:0006351 GO:0006355
81	0.09	0.670	3.07	0.15	0.86	2vprA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677 GO:0046872
82	0.09	0.612	3.87	0.11	0.86	2fd5A	GO:0003677 GO:0003700 GO:0006351 GO:0006355
83	0.08	0.630	3.85	0.13	0.87	2raeA	GO:0003677 GO:0006351 GO:0006355
84	0.07	0.583	4.44	0.10	0.89	2dg7A	GO:0003677 GO:0006351 GO:0006355
85	0.07	0.587	3.90	0.12	0.85	3kkcA	GO:0003677 GO:0006351 GO:0006355
86	0.07	0.599	4.10	0.05	0.89	2fbqA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0044212 GO:0045893 GO:0050714

Consensus prediction of GO terms

Molecular Function	GO:0003677
GO-Score	0.93
Biological Processes	GO:0006355
GO-Score	0.93
Cellular Component
GO-Score

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv2250c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]