I-TASSER results

Input Sequence in FASTA format

>protein (67 residues)
MLRRGESIIRNRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFA
LAFRDLS

Predicted Secondary Structure

Sequence	20 40 60 \| \| \| MLRRGESIIRNRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFALAFRDLS
Prediction	CCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Conf.Score	9755555554788899983457899999999999988776689999999999999999988743599
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 \| \| \| MLRRGESIIRNRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFALAFRDLS
Prediction	7455455134562454330201233333323121223343322222333323332331333334538
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60

                   |                   |                   |

Sec.Str
Seq

CCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
MLRRGESIIRNRYASKPPLYGMAMVFLAMAVVAVTAYFRMGWWSIIGYAAAAIIGVIGFALAFRDLS

4bwzA1

0.16

0.12

0.75

1.13

wMUSTER

----------------AEHLLEIFYLLLAAQVCAFIFKRLNQPVVIGEVLAGVLVPALLGLV-HEGE

1h2sB

0.25

0.19

0.76

1.01

PPAS

----GAVFI---------VGALTVLFGAIAYGEVTAAAATG--DAAAVQEAAVSAILGLIILL-NLG

5sv9A2

0.18

0.16

0.93

1.07

wMUSTER

IIHRIVFLFSDPRDNNSPLKRSMVIFLCFSLAGFTGEFAITN-AAIGFPLVLLLSVIVSFS----FT

4x5mA

0.09

1.00

0.98

wMUSTER

FAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFAVLIANIVTLFLAAPVLVITLINRR

4qncA

0.12

0.97

0.98

wMUSTER

FLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILANVVTLFFVTIILYYKLTE--

5ezmA

0.15

0.99

0.83

MUSTER

TLNAN-HIPNSFYRAYAVWVAVAFVVMLLGIAVARLLLRRGVLPSVAVYAMGMYLGFTVALLGHETV

2mmuA

0.14

0.10

0.73

0.77

dPPAS

------------------SVWFVSLFIGLMLIGLIWLMVFQLLGPWNYAIAFAFMITGLLLTMRWHL

1h2sB

0.24

0.18

0.75

0.89

wdPPAS

----GAVFI---------VGALTVLFGAIAYGEVTAAAATG--DAAAVQEAAVSAILGLIILL--IN

2mpnA

0.19

0.16

0.85

0.97

wMUSTER

LLMRQVQIA----------GGLILIGVVLGYTVNSGFFLLSGFVGAGLLFAGISGFSGMARLLDKMP

1sqqK

0.28

0.19

0.69

0.89

wPPAS

MLRRYRQLARN--------VPTASLWGAVGAVGLVWAT---WRLILDW-----VPYING---FKK--

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-0.49

Estimated TM-score = 0.65±0.13

Estimated RMSD = 4.1±2.8Å

Download Model 2

C-score=-5.00

Download Model 3

C-score=-5.00

Download Model 4

C-score=-5.00

Download Model 5

C-score=-5.00

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	1fpoA2	0.812	2.07	0.076	0.985
2	4k6jA	0.803	1.57	0.090	1.000
3	4x5mA	0.803	1.65	0.090	1.000
4	3nvoA	0.791	1.85	0.075	1.000
5	4wheA2	0.773	1.81	0.047	0.955
6	5ctgA	0.766	1.87	0.167	0.985
7	4qndA	0.762	1.94	0.075	1.000
8	4iggA	0.762	1.95	0.106	0.970
9	1ciiA	0.760	2.02	0.062	0.955
10	4ev6A	0.759	2.19	0.045	0.985

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.23	211	3uoic	HEM	Rep, Mult	23,26,27,30,49,53,56,57,59,60
2	0.07	68	2ceiA	ZN	Rep, Mult	22,55,58
3	0.05	56	3wmm7	CRT	Rep, Mult	53,57,60,61
4	0.05	58	1s5lH	CLA	Rep, Mult	44,48,51,52,54,55
5	0.05	52	2rlfB	RIM	Rep, Mult	60,61,64
6	0.05	50	3wqjA	22B	Rep, Mult	27,30,33,34,45,48,49,52,53
7	0.04	49	1pssL	BCL	Rep, Mult	43,46,47,50,51
8	0.04	45	3arcI	CLA	Rep, Mult	50,51,53,54,57,61
9	0.03	33	5e1uA	RIR	Rep, Mult	34,37,42,45,46,49
10	0.03	31	3wu2h	RRX	Rep, Mult	48,51,52,54,55,58,61
11	0.00	1	1dmrA	O	Rep, Mult	13,44
12	0.00	5	4xtnB	MPG	Rep, Mult	32,36,41,44,48
13	0.00	1	2fkwF	BCL	Rep, Mult	25,26

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.180	1urfA	0.630	2.00	0.063	0.791	2.7.11.13	27
2	0.160	1fyjA	0.592	1.28	0.020	0.687	6.1.1.15,6.1.1.17	25,50,60
3	0.142	1yvwC	0.714	2.49	0.030	0.895	3.6.1.31	NA
4	0.114	3eabA	0.610	3.06	0.048	0.925	3.6.4.3	NA
5	0.113	2a7wK	0.705	2.57	0.062	0.881	3.6.1.31	30
6	0.067	1yxbG	0.659	2.58	0.094	0.851	3.6.1.31	30,34,56,62
7	0.060	1syyA	0.665	2.85	0.060	0.940	1.17.4.1	NA
8	0.060	2zufA	0.666	3.14	0.046	0.970	6.1.1.19	NA
9	0.060	1wcrA	0.669	1.37	0.088	0.776	2.7.1.69	NA
10	0.060	3es3A	0.726	2.27	0.060	0.866	1.16.3.1	NA
11	0.060	2fenD	0.692	2.12	0.136	0.910	5.5.1.2	NA
12	0.060	2htnG	0.735	2.57	0.060	0.925	1.16.3.1	NA
13	0.060	1bg7A	0.651	1.63	0.031	0.791	1.16.3.1	NA
14	0.060	1biqB	0.670	2.81	0.104	0.970	1.17.4.1	NA
15	0.060	3c90A	0.716	2.78	0.075	0.910	3.6.1.31	27,30
16	0.060	1o9iA	0.691	2.74	0.016	0.895	1.11.1.6	NA
17	0.060	1h0nA	0.673	2.81	0.030	0.955	1.17.4.1	48
18	0.060	3e6sF	0.691	2.20	0.075	0.851	1.16.3.1	19,33
19	0.060	1xvgC	0.693	2.81	0.075	0.970	1.14.13.25	57
20	0.060	1mfrW	0.713	2.02	0.075	0.851	1.16.3.1	NA
21	0.060	1gaiA	0.688	2.88	0.104	0.985	3.2.1.3	NA
22	0.060	1krqA	0.696	1.90	0.030	0.836	1.16.3.1	61
23	0.060	1cxzB	0.668	1.77	0.036	0.806	2.7.11.13	36
24	0.060	1r03A	0.724	1.92	0.075	0.851	1.16.3.1	19
25	0.060	2uw1B	0.723	2.64	0.075	0.925	1.14.99.6	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.27	0.785	1.71	0.09	1.00	4x5mB	GO:0005886 GO:0006810 GO:0008643 GO:0016020 GO:0016021
1	0.26	0.749	1.78	0.11	0.99	4rngC	GO:0016020 GO:0016021
2	0.21	0.754	2.22	0.03	0.97	3uo2B	GO:0005739 GO:0005743 GO:0005758 GO:0005759 GO:0006457 GO:0006626 GO:0009060 GO:0016226 GO:0051087 GO:0051259
3	0.20	0.744	1.84	0.11	0.99	4qncB	GO:0005355 GO:0005886 GO:0006810 GO:0008643 GO:0015758 GO:0016020 GO:0016021 GO:0042803 GO:1904659
4	0.18	0.659	1.42	0.04	0.73	1z0jB	GO:0000011 GO:0005768 GO:0005829 GO:0005886 GO:0006810 GO:0006895 GO:0006896 GO:0006897 GO:0007596 GO:0008270 GO:0010008 GO:0010009 GO:0015031 GO:0016020 GO:0016197 GO:0017137 GO:0031901 GO:0034058 GO:0034498 GO:0043231 GO:0046872 GO:0070062 GO:0090160 GO:1903358
5	0.16	0.682	1.35	0.03	0.78	4wheA	GO:0005543 GO:0005737 GO:0005829 GO:0005886 GO:0009271 GO:0009408 GO:0016020 GO:0031234 GO:0042802 GO:0043433 GO:0060187
6	0.16	0.775	2.08	0.10	0.99	4k1nA	GO:0001541 GO:0001669 GO:0005198 GO:0005737 GO:0005794 GO:0005829 GO:0005856 GO:0005886 GO:0005911 GO:0005912 GO:0005913 GO:0005915 GO:0005925 GO:0007015 GO:0007155 GO:0007163 GO:0007406 GO:0007568 GO:0008013 GO:0008584 GO:0014070 GO:0014704 GO:0015629 GO:0016020 GO:0016264 GO:0016342 GO:0016600 GO:0017166 GO:0030027 GO:0030054 GO:0031103 GO:0034613 GO:0042127 GO:0042475 GO:0043066 GO:0043231 GO:0043297 GO:0043627 GO:0044822 GO:0045295 GO:0045296 GO:0045880 GO:0046982 GO:0051015 GO:0051291 GO:0071681 GO:0090136 GO:2000146 GO:2001045 GO:2001240 GO:2001241
7	0.15	0.640	1.33	0.02	0.69	1z0kB	GO:0000011 GO:0005768 GO:0005829 GO:0005886 GO:0006810 GO:0006895 GO:0006896 GO:0006897 GO:0007596 GO:0008270 GO:0010008 GO:0010009 GO:0015031 GO:0016020 GO:0016197 GO:0017137 GO:0031901 GO:0034058 GO:0034498 GO:0043231 GO:0046872 GO:0070062 GO:0090160 GO:1903358
8	0.14	0.791	1.85	0.07	1.00	3nvoA	GO:0005385 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0006829 GO:0016020 GO:0016021 GO:0030001 GO:0046873 GO:0055085 GO:0071577 GO:0098655
9	0.14	0.777	1.79	0.18	1.00	5ctgB	GO:0005886 GO:0005887 GO:0006810 GO:0008643 GO:0016020 GO:0016021 GO:0034219 GO:0051119
10	0.14	0.770	2.10	0.10	0.99	4iggB	GO:0001541 GO:0001669 GO:0005198 GO:0005737 GO:0005794 GO:0005829 GO:0005856 GO:0005886 GO:0005911 GO:0005912 GO:0005913 GO:0005915 GO:0005925 GO:0007015 GO:0007155 GO:0007163 GO:0007406 GO:0007568 GO:0008013 GO:0008584 GO:0014070 GO:0014704 GO:0015629 GO:0016020 GO:0016264 GO:0016342 GO:0016600 GO:0017166 GO:0030027 GO:0030054 GO:0031103 GO:0034332 GO:0034613 GO:0042127 GO:0042475 GO:0043066 GO:0043231 GO:0043297 GO:0043627 GO:0044822 GO:0045295 GO:0045296 GO:0045880 GO:0051015 GO:0051149 GO:0051291 GO:0071681 GO:0090136 GO:0098641 GO:2000146 GO:2001045 GO:2001240 GO:2001241
11	0.12	0.691	2.52	0.07	0.99	1st6A	GO:0001725 GO:0002009 GO:0002162 GO:0003779 GO:0005198 GO:0005623 GO:0005737 GO:0005743 GO:0005856 GO:0005886 GO:0005903 GO:0005911 GO:0005912 GO:0005913 GO:0005915 GO:0005916 GO:0005925 GO:0005927 GO:0007155 GO:0008013 GO:0015629 GO:0016020 GO:0017166 GO:0030018 GO:0030032 GO:0030054 GO:0030334 GO:0030486 GO:0031594 GO:0031625 GO:0034333 GO:0034394 GO:0042383 GO:0042803 GO:0043034 GO:0043234 GO:0043297 GO:0045121 GO:0045294 GO:0045296 GO:0048675 GO:0051015 GO:0051371 GO:0051393 GO:0070062 GO:0070527 GO:0090136 GO:0090636 GO:0090637 GO:0097110 GO:0098723 GO:1903561 GO:1990357
12	0.12	0.751	2.37	0.03	0.99	3uo3A	GO:0005739 GO:0005743 GO:0005758 GO:0005759 GO:0006457 GO:0006626 GO:0009060 GO:0016226 GO:0051087 GO:0051259
13	0.11	0.719	2.62	0.04	0.99	3bvoA	GO:0005634 GO:0005737 GO:0005739 GO:0006457 GO:0016226 GO:0046872 GO:0051087 GO:0051259
14	0.10	0.796	1.60	0.09	1.00	4k6jB	GO:0000775 GO:0000785 GO:0000795 GO:0000798 GO:0005634 GO:0005654 GO:0005694 GO:0005737 GO:0005829 GO:0007049 GO:0007062 GO:0007064 GO:0007067 GO:0008156 GO:0008278 GO:0009636 GO:0015630 GO:0016032 GO:0035562 GO:0043231 GO:0045132 GO:0045875 GO:0048146 GO:0051301 GO:0051983 GO:0060623 GO:0071168 GO:0071922
15	0.10	0.777	2.19	0.04	0.99	4it5B	GO:0006457 GO:0016226 GO:0051087 GO:0051259
16	0.10	0.703	2.43	0.08	0.96	3ck6E	GO:0005886 GO:0016020 GO:0016021 GO:0030001 GO:0046873 GO:0055085
17	0.10	0.803	1.57	0.09	1.00	4k6jA	GO:0000775 GO:0000785 GO:0000795 GO:0000798 GO:0005634 GO:0005654 GO:0005694 GO:0005737 GO:0005829 GO:0007049 GO:0007062 GO:0007064 GO:0007067 GO:0008156 GO:0008278 GO:0009636 GO:0015630 GO:0016032 GO:0035562 GO:0043231 GO:0045132 GO:0045875 GO:0048146 GO:0051301 GO:0051983 GO:0060623 GO:0071168 GO:0071922
18	0.08	0.667	2.10	0.04	0.81	3dyjA	GO:0001726 GO:0003779 GO:0005178 GO:0005200 GO:0005737 GO:0005815 GO:0005856 GO:0005886 GO:0005925 GO:0007016 GO:0007044 GO:0007155 GO:0009986 GO:0016020 GO:0017166 GO:0030054 GO:0030274 GO:0030866 GO:0032403 GO:0032587 GO:0042995 GO:0051015 GO:0070062 GO:0070527
19	0.08	0.559	2.60	0.04	0.84	1dowA	GO:0001541 GO:0001669 GO:0005198 GO:0005737 GO:0005794 GO:0005829 GO:0005856 GO:0005886 GO:0005911 GO:0005912 GO:0005913 GO:0005915 GO:0005925 GO:0007015 GO:0007155 GO:0007163 GO:0007406 GO:0007568 GO:0008013 GO:0008584 GO:0014070 GO:0014704 GO:0015629 GO:0016020 GO:0016264 GO:0016342 GO:0016600 GO:0017166 GO:0030027 GO:0030054 GO:0031103 GO:0034613 GO:0042127 GO:0042475 GO:0043066 GO:0043231 GO:0043297 GO:0043627 GO:0044822 GO:0045295 GO:0045296 GO:0045880 GO:0046982 GO:0051015 GO:0051291 GO:0071681 GO:0090136 GO:2000146 GO:2001045 GO:2001240 GO:2001241
20	0.07	0.491	2.61	0.08	0.61	2c2lA	GO:0000151 GO:0000209 GO:0001664 GO:0004842 GO:0005634 GO:0005654 GO:0005737 GO:0005783 GO:0005886 GO:0006281 GO:0006457 GO:0006511 GO:0006515 GO:0006974 GO:0016567 GO:0016874 GO:0019899 GO:0019900 GO:0030018 GO:0030544 GO:0030579 GO:0030674 GO:0030911 GO:0030968 GO:0031072 GO:0031371 GO:0031398 GO:0031625 GO:0031647 GO:0031943 GO:0032091 GO:0032436 GO:0034450 GO:0036503 GO:0042405 GO:0042787 GO:0042803 GO:0043161 GO:0045111 GO:0046332 GO:0051443 GO:0051604 GO:0051787 GO:0051865 GO:0051879 GO:0061630 GO:0070062 GO:0070534 GO:0071218 GO:0090035 GO:1904264

Consensus prediction of GO terms

Molecular Function	GO:0046983	GO:0042802	GO:0015149	GO:0017016	GO:0046914
GO-Score	0.41	0.41	0.41	0.36	0.36
Biological Processes	GO:0051188	GO:0072655	GO:0006461	GO:0006839	GO:0031163	GO:0006605	GO:0006790	GO:0007005	GO:0045333	GO:0035428	GO:0007033	GO:0006896	GO:0048308	GO:0007041	GO:0007599	GO:0050817	GO:0042147	GO:0006906	GO:0042060	GO:0033043	GO:0007030
GO-Score	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.43	0.41	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36
Cellular Component	GO:0016021	GO:0005886	GO:0031966	GO:0070013	GO:0019866	GO:0031970	GO:0005774	GO:0031988	GO:1903561	GO:0005769	GO:0044440	GO:0098562
GO-Score	0.57	0.52	0.43	0.43	0.43	0.43	0.36	0.36	0.36	0.36	0.36	0.36

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv2128

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]