I-TASSER results

Input Sequence in FASTA format

>protein (97 residues)
MWIGWLEFDVLLGDVRSLKQKRSVTRPLVAELQRKFSVSAAETGSHDLYRRAGIGVAVVS
GDRSHAVDVLDNAERLVAAHPEFELLSVRRGLHRTDD

Predicted Secondary Structure

Sequence	20 40 60 80 \| \| \| \| MWIGWLEFDVLLGDVRSLKQKRSVTRPLVAELQRKFSVSAAETGSHDLYRRAGIGVAVVSGDRSHAVDVLDNAERLVAAHPEFELLSVRRGLHRTDD
Prediction	CEEEEEEEEEEHCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEHCCCCCCCEEEEEEEEEHCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEHCCCC
Conf.Score	9589999999987988989999999999999998557478985688865468999999859999999999999999998899699999999867899
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 \| \| \| \| MWIGWLEFDVLLGDVRSLKQKRSVTRPLVAELQRKFSVSAAETGSHDLYRRAGIGVAVVSGDRSHAVDVLDNAERLVAAHPEFELLSVRRGLHRTDD
Prediction	3400303020304405314422431430154047424000010355433420100000004446304510530151037334120140334134588
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80

                   |                   |                   |                   |

Sec.Str
Seq

CEEEEEEEEEEHCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEHCCCCCCCEEEEEEEEEHCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEHCCCC
MWIGWLEFDVLLGDVRSLKQKRSVTRPLVAELQRKFSVSAAETGSHDLYRRAGIGVAVVSGDRSHAVDVLDNAERLVAAHPEFELLSVRRGLHRTDD

1j27A

0.23

0.99

3.31

MUSTER

AYLGLYTARLETP-ARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGFQVALEEFRLEAFEL

1j27A

0.23

0.99

5.67

dPPAS

AYLGLYTARLETP-ARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGFQVALEEFRLEAFEL

1j27A

0.23

0.99

5.51

wdPPAS

AYLGLYTARLETP-ARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGFQVALEEFRLEAFEL

1j27A

0.23

0.99

4.02

wMUSTER

AYLGLYTARLETP-ARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGFQVALEEFRLEAFEL

1j27A

0.23

0.97

4.60

wPPAS

AYLGLYTARLETP-ARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGFQVALEEFRLEA--E

1j27A

0.23

0.99

14.57

dPPAS2

AYLGLYTARLETP-ARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGFQVALEEFRLEAFEL

1j27A

0.23

0.99

4.54

PPAS

AYLGLYTARLETP-ARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGFQVALEEFRLEAFEL

1j27A

0.23

0.99

4.81

Env-PPAS

AYLGLYTARLETP-ARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGFQVALEEFRLEAFEL

2mq8A

0.14

0.13

0.98

1.05

MUSTER

MLTVEVEVKITADDENAEEIVKRVIDEVEREVQKQYNATITRTLTRD--GTVELRIKVKADTEEKAKSIIKLIEERIEEEPNATITRTVRTEVGSSW

2kl8A

0.12

0.10

0.88

1.24

dPPAS

-----MEMDIRFRG-DDLEAFEKALKEMIRQARKFAGTVTYTLDGND------LEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRLEHHHHHH

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 3 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=1.76

Estimated TM-score = 0.96±0.05

Estimated RMSD = 0.7±0.7Å

Download Model 2

C-score=-1.94

Download Model 3

C-score=-3.82

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	1j27A	0.967	0.56	0.229	0.990
2	4ewtA	0.728	2.47	0.095	0.959
3	4pxbA	0.718	2.54	0.074	0.969
4	1z2lA2	0.716	2.55	0.054	0.949
5	2d6fD3	0.715	2.73	0.053	0.949
6	5i4mA	0.714	2.54	0.096	0.959
7	4wjbA	0.711	2.52	0.054	0.949
8	1cg2A	0.711	2.71	0.084	0.959
9	4hppA	0.710	2.68	0.128	0.969
10	3n5fA	0.708	2.53	0.053	0.959

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.11	7	1wc1A	TAT	Rep, Mult	9,10,12,43,44,53
2	0.09	5	1wc6A	MG	Rep, Mult	9,10,52,87
3	0.05	3	2bw7A	APC	Rep, Mult	10,11,12,45,46,85
4	0.05	3	2qc8F	MN	Rep, Mult	5,7,42,55
5	0.03	2	2raqA	CA	Rep, Mult	42,47
6	0.03	2	1wc4A	UUU	Rep, Mult	10,11,12,13,15,45,46
7	0.03	2	3wc0A	GTP	Rep, Mult	7,89
8	0.02	1	1ab8B	FOK	Rep, Mult	25,41,42
9	0.02	1	2a6h3	III	Rep, Mult	26,30,34
10	0.02	1	3eywA	ZN	Rep, Mult	49,65
11	0.02	1	1gd2I	III	Rep, Mult	15,18,19
12	0.02	1	2hfoE	FMN	Rep, Mult	8,25,29,32,33,52,54,76,77,80,82,83
13	0.02	1	1cul0	III	Rep, Mult	20,21,23,24,27,31
14	0.02	1	3maaB	FKP	Rep, Mult	28,29,32,55

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.241	2acyA	0.617	2.45	0.049	0.814	3.6.1.7	34
2	0.217	1urrA	0.624	2.65	0.098	0.835	3.6.1.7	34
3	0.214	1gxtA	0.576	2.48	0.160	0.753	2.1.3.-	26
4	0.175	1mwyA	0.557	2.67	0.083	0.742	3.6.3.3,3.6.3.5	10,85
5	0.166	1aw0A	0.560	2.45	0.086	0.722	3.6.3.4	35,75
6	0.163	1kviA	0.574	2.58	0.053	0.773	3.6.3.4	38,83
7	0.162	1s6oA	0.513	2.88	0.108	0.763	3.6.3.4	32
8	0.161	2ko1A	0.593	2.98	0.073	0.845	2.7.6.5	10,25
9	0.136	1fvqA	0.564	2.32	0.114	0.722	3.6.3.4	25
10	0.134	2pq4A	0.560	2.91	0.076	0.804	1.7.99.4	41,54,56,87
11	0.122	3cjkA	0.543	2.44	0.088	0.701	3.6.3.4	38
12	0.102	1v3zA	0.575	2.80	0.066	0.783	3.6.1.7	NA
13	0.101	1y3jA	0.542	2.87	0.105	0.742	3.6.3.4	NA
14	0.100	1w2iA	0.575	2.80	0.066	0.783	3.6.1.7	34
15	0.088	2k7jA	0.613	2.67	0.037	0.825	3.6.1.7	NA
16	0.086	2gv1A	0.593	2.73	0.091	0.794	3.6.1.7	NA
17	0.085	1ulrA	0.595	2.72	0.127	0.794	3.6.1.7	NA
18	0.072	2fhmA	0.582	2.67	0.100	0.804	3.6.1.7	NA
19	0.068	1apsA	0.621	2.57	0.073	0.825	3.6.1.7	34
20	0.066	1fwpA	0.498	2.68	0.103	0.701	2.7.13.3	NA
21	0.060	1fnoA	0.640	2.83	0.090	0.897	3.4.11.4	13
22	0.060	3ikmD	0.646	3.01	0.103	0.887	2.7.7.7	NA
23	0.060	2gl6A	0.571	2.98	0.068	0.856	2.7.3.2	NA
24	0.060	1cg2A	0.711	2.71	0.084	0.959	3.4.17.11	42
25	0.060	3ic1A	0.655	2.95	0.074	0.928	3.5.1.18	NA
26	0.060	1r3nA	0.708	2.61	0.042	0.969	3.5.1.6	NA
27	0.060	3gb0A	0.677	2.90	0.043	0.938	3.4.11.-	69
28	0.060	1n16B	0.576	3.15	0.068	0.887	2.7.3.2	51
29	0.060	1vgyA	0.683	2.93	0.074	0.959	3.5.1.18	NA
30	0.060	1m5sD	0.643	3.01	0.034	0.897	2.3.1.101	29,45
31	0.060	2lgsA	0.675	2.84	0.074	0.969	6.3.1.2	51
32	0.060	2d1cA	0.647	2.65	0.093	0.876	1.1.1.42	NA
33	0.060	1f1hL	0.674	2.97	0.074	0.979	6.3.1.2	35,78
34	0.060	2uu7A	0.697	2.80	0.097	0.959	6.3.1.2	NA
35	0.060	1f1hA	0.674	2.97	0.074	0.979	6.3.1.2	NA
36	0.060	2d3aA	0.690	2.83	0.108	0.959	6.3.1.2	NA
37	0.060	3fkyC	0.701	2.73	0.097	0.959	6.3.1.2	NA
38	0.060	1htoA	0.697	2.63	0.120	0.949	6.3.1.2	NA
39	0.060	3ju5C	0.661	2.57	0.067	0.876	2.7.3.3	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.19	0.533	2.66	0.14	0.72	2ldiA	GO:0000166 GO:0005385 GO:0005524 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0006812 GO:0006829 GO:0015086 GO:0016020 GO:0016021 GO:0016463 GO:0016787 GO:0019829 GO:0030001 GO:0043231 GO:0046872 GO:0070574 GO:0071577 GO:0098655
1	0.17	0.560	2.45	0.09	0.72	1aw0A	GO:0000166 GO:0001568 GO:0001701 GO:0001974 GO:0002082 GO:0004008 GO:0005375 GO:0005507 GO:0005524 GO:0005737 GO:0005770 GO:0005783 GO:0005794 GO:0005802 GO:0005829 GO:0005886 GO:0005887 GO:0006568 GO:0006584 GO:0006810 GO:0006811 GO:0006812 GO:0006825 GO:0006878 GO:0007005 GO:0007595 GO:0007626 GO:0010041 GO:0010043 GO:0010273 GO:0015677 GO:0015679 GO:0016020 GO:0016021 GO:0016323 GO:0016532 GO:0016787 GO:0018205 GO:0019430 GO:0019829 GO:0021702 GO:0021860 GO:0021954 GO:0030001 GO:0030140 GO:0030141 GO:0030198 GO:0030199 GO:0031069 GO:0031526 GO:0032767 GO:0034220 GO:0042093 GO:0042414 GO:0042415 GO:0042417 GO:0042428 GO:0043005 GO:0043025 GO:0043085 GO:0043086 GO:0043473 GO:0043588 GO:0046688 GO:0046872 GO:0048251 GO:0048286 GO:0048471 GO:0048812 GO:0051216 GO:0051353 GO:0051542 GO:0060003
2	0.17	0.514	2.16	0.13	0.64	4zoqF	GO:0004252 GO:0006508 GO:0008233
3	0.17	0.533	2.47	0.10	0.71	1osdA	GO:0015097 GO:0015694 GO:0030001 GO:0042597 GO:0045340 GO:0046689 GO:0046872
4	0.16	0.548	2.75	0.14	0.74	2crlA	GO:0000302 GO:0004784 GO:0005507 GO:0005634 GO:0005737 GO:0005829 GO:0005913 GO:0006801 GO:0008270 GO:0015035 GO:0015680 GO:0016532 GO:0019430 GO:0030001 GO:0046872 GO:0051353 GO:0055114 GO:0098609 GO:0098641
5	0.15	0.543	2.44	0.09	0.70	3cjkA	GO:0005375 GO:0005507 GO:0005829 GO:0006810 GO:0006811 GO:0006825 GO:0006878 GO:0006979 GO:0015680 GO:0016530 GO:0016531 GO:0030001 GO:0032767 GO:0035434 GO:0046872
6	0.14	0.708	2.61	0.04	0.97	1r3nA	GO:0003837 GO:0008152 GO:0016787 GO:0016813 GO:0046872
7	0.14	0.452	2.58	0.07	0.62	1sb6A	GO:0005507 GO:0005737 GO:0030001 GO:0046872 GO:0046916
8	0.14	0.514	2.37	0.10	0.65	2k2pA	GO:0030001 GO:0046872
9	0.14	0.535	2.54	0.04	0.72	1k0vA	GO:0005507 GO:0005737 GO:0006825 GO:0030001 GO:0046872
10	0.14	0.535	2.51	0.07	0.71	2l3mA	GO:0005507 GO:0006825 GO:0030001 GO:0046872
11	0.14	0.525	2.56	0.09	0.72	1afiA	GO:0006810 GO:0015097 GO:0015694 GO:0030001 GO:0042597 GO:0045340 GO:0046689 GO:0046872
12	0.13	0.673	3.04	0.07	0.94	4wj3B	GO:0000166 GO:0005524 GO:0006412 GO:0016874 GO:0016884 GO:0032543 GO:0050567 GO:0070681
13	0.13	0.715	2.69	0.03	0.97	3ramA	GO:0008152 GO:0016787
14	0.13	0.691	2.27	0.10	0.89	2q43A	GO:0005783 GO:0005788 GO:0006508 GO:0008152 GO:0008270 GO:0009850 GO:0010178 GO:0010179 GO:0016787 GO:0043171 GO:0070573
15	0.12	0.714	2.54	0.10	0.96	5i4mA	GO:0008152 GO:0016787 GO:0016813 GO:0050538
16	0.12	0.715	2.73	0.05	0.95	2d6fD	GO:0000166 GO:0004812 GO:0005524 GO:0005737 GO:0006412 GO:0016874 GO:0016884 GO:0050567
17	0.12	0.364	3.88	0.07	0.56	1zq1C	GO:0000166 GO:0004812 GO:0005524 GO:0005737 GO:0006412 GO:0016874 GO:0016884 GO:0050567
18	0.11	0.728	2.47	0.10	0.96	4ewtA	GO:0008152 GO:0016787
19	0.11	0.685	2.73	0.11	0.96	3io1A	GO:0008152 GO:0016787
20	0.11	0.579	3.29	0.02	0.86	3al0B	GO:0000166 GO:0005524 GO:0006412 GO:0016874 GO:0016884 GO:0032543 GO:0050567 GO:0070681
21	0.11	0.543	2.79	0.07	0.73	1q8lA	GO:0000166 GO:0001568 GO:0001701 GO:0001974 GO:0002082 GO:0004008 GO:0005375 GO:0005507 GO:0005524 GO:0005737 GO:0005770 GO:0005783 GO:0005794 GO:0005802 GO:0005829 GO:0005886 GO:0005887 GO:0006568 GO:0006584 GO:0006810 GO:0006811 GO:0006812 GO:0006825 GO:0006878 GO:0007005 GO:0007595 GO:0007626 GO:0010041 GO:0010043 GO:0010273 GO:0015677 GO:0015679 GO:0016020 GO:0016021 GO:0016323 GO:0016532 GO:0016787 GO:0018205 GO:0019430 GO:0019829 GO:0021702 GO:0021860 GO:0021954 GO:0030001 GO:0030140 GO:0030141 GO:0030198 GO:0030199 GO:0031069 GO:0031526 GO:0032767 GO:0034220 GO:0042093 GO:0042414 GO:0042415 GO:0042417 GO:0042428 GO:0043005 GO:0043025 GO:0043085 GO:0043086 GO:0043473 GO:0043588 GO:0046688 GO:0046872 GO:0048251 GO:0048286 GO:0048471 GO:0048812 GO:0051216 GO:0051353 GO:0051542 GO:0060003
22	0.10	0.697	2.49	0.09	0.92	4pxdA	GO:0000256 GO:0006144 GO:0008152 GO:0009442 GO:0016787 GO:0016813 GO:0030145 GO:0042803 GO:0046872 GO:0047652
23	0.10	0.572	3.15	0.02	0.90	3ip4B	GO:0000166 GO:0005524 GO:0006412 GO:0016874 GO:0016884 GO:0050567
24	0.10	0.697	2.53	0.10	0.93	1ysjA	GO:0006508 GO:0008152 GO:0008270 GO:0016787 GO:0043171 GO:0070573
25	0.10	0.375	4.11	0.08	0.59	3kfuF	GO:0000166 GO:0005524 GO:0006412 GO:0016874 GO:0016884 GO:0050567
26	0.09	0.589	3.61	0.05	0.94	4n0hB	GO:0000166 GO:0005524 GO:0005739 GO:0006412 GO:0016874 GO:0016884 GO:0030956 GO:0032543 GO:0050567 GO:0070681
27	0.09	0.578	3.17	0.05	0.85	3h0lB	GO:0000166 GO:0005524 GO:0006412 GO:0016874 GO:0016884 GO:0032543 GO:0050567 GO:0070681
28	0.08	0.625	2.92	0.12	0.94	1lfwA	GO:0005737 GO:0006508 GO:0008152 GO:0008233 GO:0008237 GO:0008270 GO:0016787 GO:0016805 GO:0046872
29	0.07	0.557	2.67	0.08	0.74	1mwyA	GO:0000166 GO:0005524 GO:0005886 GO:0005887 GO:0006812 GO:0006824 GO:0006829 GO:0008551 GO:0010312 GO:0015087 GO:0015094 GO:0015099 GO:0015692 GO:0016020 GO:0016021 GO:0016463 GO:0016787 GO:0016887 GO:0019829 GO:0030001 GO:0035444 GO:0043231 GO:0046686 GO:0046872 GO:0070574 GO:0071577 GO:0098655
30	0.07	0.525	2.74	0.14	0.73	1fd8A	GO:0005737 GO:0005829 GO:0006810 GO:0006811 GO:0006825 GO:0006878 GO:0006879 GO:0015680 GO:0016531 GO:0030001 GO:0034599 GO:0046872
31	0.07	0.684	2.82	0.06	0.95	4o23A	GO:0008152 GO:0008270 GO:0008652 GO:0009014 GO:0009085 GO:0009089 GO:0016787 GO:0019877 GO:0046872 GO:0050897
32	0.07	0.708	2.53	0.05	0.96	3n5fA	GO:0008152 GO:0016787 GO:0016813 GO:0042802 GO:0050538

Consensus prediction of GO terms

Molecular Function	GO:0072509	GO:0043682	GO:0004175	GO:0008236	GO:0005524	GO:0016209	GO:0098632	GO:0045296	GO:0016721	GO:0015036	GO:0016532
GO-Score	0.39	0.35	0.35	0.35	0.34	0.31	0.31	0.31	0.31	0.31	0.30
Biological Processes	GO:0015691	GO:0006829	GO:0035434	GO:0001501	GO:0030879	GO:0030324	GO:0048858	GO:0021859	GO:0006586	GO:0042325	GO:0006119	GO:1990169	GO:0006996	GO:0001942	GO:0048771	GO:1901160	GO:0018193	GO:0010039	GO:0009101	GO:0009072	GO:1901605	GO:0061448	GO:0031175	GO:0007589	GO:0032941	GO:1903578	GO:0044092	GO:0085029	GO:0048730	GO:0051541	GO:0043009	GO:0055070	GO:0007610	GO:0002294	GO:0021694	GO:0001944	GO:0021884	GO:0021533	GO:0071822	GO:0043467	GO:0006584	GO:0046916	GO:0050787	GO:1902582	GO:0019430	GO:0051353
GO-Score	0.39	0.39	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.34	0.31	0.30	0.30
Cellular Component	GO:0099503	GO:0030136	GO:0044297	GO:0005903	GO:0031253	GO:0030133	GO:0036477	GO:0005798	GO:0098791	GO:0005768	GO:0005887	GO:0005911	GO:0005912	GO:0005829
GO-Score	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.34	0.31	0.31	0.30

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv2117

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]