I-TASSER results

I-TASSER results for job id Rv2053c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Input Sequence in FASTA format

>protein (175 residues)
MSRLLLSYAVVELAVVFALAATIGFGWTLLVLLATFVLGFGLLAPLGGWQLGRRLLWLRS
GLAEPRSALSDGALVTVASVLVLVPGLVTTTMGLLLLVPPIRALARPGLTAIAVRGFLRN
VPLTADAAANMAGAFGESGTDPDFIDGEVIDVIDVEPLTLQPPRVAAEPPSPGSN

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 \| \| \| \| \| \| \| \| MSRLLLSYAVVELAVVFALAATIGFGWTLLVLLATFVLGFGLLAPLGGWQLGRRLLWLRSGLAEPRSALSDGALVTVASVLVLVPGLVTTTMGLLLLVPPIRALARPGLTAIAVRGFLRNVPLTADAAANMAGAFGESGTDPDFIDGEVIDVIDVEPLTLQPPRVAAEPPSPGSN
Prediction	CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEHCCCCCCCCCCCCCCCCCCCCCCC
Conf.Score	9567689999999999999999959999999999999999999999999999999999988999789999999999999999976699999999999768999999999999998887656666677777788888888899858999999579998888899999999998889
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 \| \| \| \| \| \| \| \| MSRLLLSYAVVELAVVFALAATIGFGWTLLVLLATFVLGFGLLAPLGGWQLGRRLLWLRSGLAEPRSALSDGALVTVASVLVLVPGLVTTTMGLLLLVPPIRALARPGLTAIAVRGFLRNVPLTADAAANMAGAFGESGTDPDFIDGEVIDVIDVEPLTLQPPRVAAEPPSPGSN
Prediction	4331131313323321233133333331323333233313311332034203411441464543234310211023321331333243223313302323324302420343144323543444444444444444565754310103133354865665645655774564488
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160

                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEHCCCCCCCCCCCCCCCCCCCCCCC
MSRLLLSYAVVELAVVFALAATIGFGWTLLVLLATFVLGFGLLAPLGGWQLGRRLLWLRSGLAEPRSALSDGALVTVASVLVLVPGLVTTTMGLLLLVPPIRALARPGLTAIAVRGFLRNVPLTADAAANMAGAFGESGTDPDFIDGEVIDVIDVEPLTLQPPRVAAEPPSPGSN

3j5pB2

0.13

0.10

0.78

1.78

dPPAS2

---FQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIEDGLYSTCLELFKFTIGMGFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAGGGGGGGGGGG------------------------------------

4bwzA2

0.14

0.10

0.69

1.62

dPPAS2

ILGAAVIDDVLGLIVLACVNGVAETGPVVLVAGTVVTVIAILGKVLGGFLGALTQGVRSALTVGCGMAPRGEVGLIVAALGLKAEEEYAIVLFMVVFTTLFAPFALKPLIAWTERERAAKE------------------------------------------------------

4ke2A

0.13

0.99

0.81

MUSTER

KAAVTAADAAAAAATIAASAASVAAATAADDAAASIATINAASAAAKSIAAAAAMAAKDTAAAAASAAAAAVASAAKALETINVKAAYAAATTANTAAAAAAATATTAAAAAAAKATIDNAAAAKAAAVATAVSDAAATAATAA--VAAATLEAAAAKAAATAVSAAAAAAAAAI

3j5pB2

0.13

0.10

0.78

0.99

dPPAS

---FQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIEDGLYSTCLELFKFTIGMGFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAGGGGGGGGGGG------------------------------------

3j5pB2

0.13

0.10

0.78

0.96

wdPPAS

---FQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIEDGLYSTCLELFKFTIGMGDKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAGGGGGGGGGGG------------------------------------

3j5pB2

0.13

0.10

0.78

0.85

wMUSTER

---FQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIEDGLYSTCLELFKFTIGMGDKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAGGGGGGGGGGG------------------------------------

4ri2A

0.17

0.12

0.72

0.85

wPPAS

M-IGFAASLLGEGIT---ILSQLNIPIYEAEPLLLFFILFTLLGAIGALGDRGRFVDEPTFGFTKSNELFVGRLAQLGFAFSLIGEIIT-ALAQLNIETPINEIEPLVLLNVVFFFIAAINPG----------------------TGKFITDD----------------------

2x2vA

0.09

0.03

0.39

1.56

dPPAS2

--------------AFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMF-IGVPLAEAVPIIAIVISLLILF--------------------------------------------------------------------------------------------

3j5pB2

0.13

0.10

0.78

0.91

PPAS

---FQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIEDGLYSTCLELFKFTIGMGDKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAGGGGGGGGGGG------------------------------------

2or0B3

0.12

0.11

0.98

0.74

Env-PPAS

IRLLQRLYHPREFAETVGVAALDGASGWVTGIVGVHPWELAFADPQVQEEIWGEDNDTWASPYAPGVATPVDGGYVLKGRWSFSSGTDHQWAFLGAVGDGEGGIATPSSLHVILPRTDYQIVEDTWDVIGLRGTG----SKDLIVDGAFVPGYRTLNAAKVDGRAQKEAGRPEPL

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-2.54

Estimated TM-score = 0.42±0.14

Estimated RMSD = 10.8±4.6Å

Download Model 2

C-score=-3.54

Download Model 3

C-score=-3.42

Download Model 4

C-score=-4.61

Download Model 5

C-score=-5.00

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	3j5pB	0.714	2.12	0.115	0.783
2	3j9pD	0.619	3.29	0.117	0.794
3	5e1jA	0.593	3.78	0.038	0.794
4	5an8A	0.543	3.60	0.112	0.766
5	3jbrA	0.499	3.67	0.041	0.674
6	2o8fA2	0.496	4.24	0.055	0.703
7	4dxwA	0.487	2.32	0.101	0.560
8	1e3mA	0.486	4.43	0.078	0.697
9	1y2mB	0.481	4.46	0.077	0.697
10	1nneA	0.479	4.20	0.064	0.674

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.08	3	1ng9B	ADP	Rep, Mult	33,52,53,56,70,71,72,73,74,75
2	0.05	2	1ykpA	DHB	Rep, Mult	91,93,99
3	0.05	2	1e3mA	ADP	Rep, Mult	37,65,69,70,71,72,73,74
4	0.03	1	3d1lA	MPR	Rep, Mult	46,65
5	0.03	1	1e3mB	QNA	Rep, Mult	28,30,78
6	0.03	1	2wscJ	CLA	Rep, Mult	65,70
7	0.03	1	4fe1I	CLA	Rep, Mult	35,38,39
8	0.03	1	1lghA	DET	Rep, Mult	14,21
9	0.03	1	2r9rH	PGW	Rep, Mult	30,48,49,52
10	0.03	1	5is0C	6ET	Rep, Mult	36,71,78
11	0.03	1	3attA	MG	Rep, Mult	146,148
12	0.03	1	3ngiA	CA	Rep, Mult	148,168
13	0.03	1	3mi1B	FE	Rep, Mult	91,93
14	0.03	1	1g42A	CA	Rep, Mult	85,88
15	0.03	1	1oh6B	QNA	Rep, Mult	52,53,74,80

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	1z0hB	0.372	5.73	0.019	0.680	3.4.24.69	NA
2	0.060	1itwB	0.434	5.60	0.091	0.789	1.1.1.42	34,37,72
3	0.060	1gpjA	0.455	4.77	0.052	0.714	1.2.1.70	NA
4	0.060	1o0uB	0.441	4.81	0.067	0.691	2.7.1.31	NA
5	0.060	2vumA	0.361	5.20	0.052	0.589	2.7.7.6	NA
6	0.060	2iukA	0.387	5.39	0.038	0.646	1.13.11.12	NA
7	0.060	1n1hA	0.420	5.11	0.036	0.703	2.7.7.48	22,87
8	0.060	2ajqA	0.436	4.51	0.030	0.663	2.7.7.7	NA
9	0.060	1ynnD	0.351	4.13	0.042	0.497	2.7.7.6	46
10	0.060	2iz1B	0.439	4.05	0.045	0.623	1.1.1.44	NA
11	0.060	2vuaA	0.327	6.04	0.049	0.651	3.4.24.69	53,74,79
12	0.060	3g61A	0.432	4.89	0.060	0.697	3.6.3.44	NA
13	0.060	2r0nA	0.416	5.38	0.061	0.726	1.3.99.7	73
14	0.060	1jqnA	0.434	4.59	0.088	0.686	4.1.1.31	NA
15	0.060	2jkvA	0.423	3.94	0.042	0.611	1.1.1.44	NA
16	0.060	2b0tA	0.418	5.55	0.073	0.760	1.1.1.42	31
17	0.060	1no3A	0.441	4.49	0.040	0.651	1.13.11.12	NA
18	0.060	3fwnA	0.471	3.40	0.070	0.634	1.1.1.44	NA
19	0.060	2zj7A	0.418	5.41	0.070	0.731	3.1.1.3	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.08	0.619	3.29	0.12	0.79	3j9pA	GO:0005215 GO:0005216 GO:0005262 GO:0005363 GO:0005622 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0006816 GO:0006974 GO:0007166 GO:0008643 GO:0009409 GO:0010033 GO:0014070 GO:0015267 GO:0015278 GO:0015768 GO:0016020 GO:0016021 GO:0019233 GO:0030288 GO:0032421 GO:0034289 GO:0042493 GO:0042542 GO:0042597 GO:0042956 GO:0043190 GO:0048265 GO:0050896 GO:0050955 GO:0050966 GO:0050968 GO:0051209 GO:0051289 GO:0055052 GO:0055085 GO:0060326 GO:0070588 GO:0097604 GO:1901982 GO:1990060
1	0.07	0.543	3.60	0.11	0.77	5an8A	GO:0005216 GO:0005261 GO:0005262 GO:0005622 GO:0005886 GO:0006810 GO:0006811 GO:0009266 GO:0009408 GO:0009986 GO:0016020 GO:0016021 GO:0030424 GO:0032584 GO:0044295 GO:0044297 GO:0045773 GO:0055085 GO:0070588 GO:0090280
2	0.07	0.681	1.82	0.11	0.73	3j5pA	GO:0000122 GO:0000166 GO:0001659 GO:0001660 GO:0001774 GO:0002024 GO:0002790 GO:0004888 GO:0005216 GO:0005231 GO:0005261 GO:0005262 GO:0005516 GO:0005524 GO:0005829 GO:0005886 GO:0005887 GO:0006629 GO:0006810 GO:0006811 GO:0006816 GO:0006954 GO:0007165 GO:0007204 GO:0008324 GO:0009268 GO:0009408 GO:0009897 GO:0010243 GO:0014047 GO:0014832 GO:0015276 GO:0015278 GO:0016020 GO:0016021 GO:0017081 GO:0019233 GO:0030054 GO:0030425 GO:0031226 GO:0032591 GO:0034220 GO:0042802 GO:0042995 GO:0043005 GO:0043025 GO:0043065 GO:0043434 GO:0045202 GO:0045211 GO:0045429 GO:0048265 GO:0048266 GO:0050954 GO:0050960 GO:0050965 GO:0050968 GO:0051209 GO:0055085 GO:0060083 GO:0060454 GO:0070588 GO:0071312 GO:0071318 GO:0071345 GO:0071356 GO:0071363 GO:0071502 GO:0090212 GO:0097603 GO:1990090
3	0.07	0.620	3.29	0.11	0.79	5hi9A	GO:0005216 GO:0005262 GO:0005622 GO:0005737 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0006816 GO:0008285 GO:0009408 GO:0012505 GO:0016020 GO:0016021 GO:0030027 GO:0042470 GO:0055085 GO:0070588
4	0.06	0.277	4.81	0.06	0.45	5et1A	GO:0003779 GO:0005737 GO:0005856 GO:0005902 GO:0005903 GO:0007605 GO:0007626 GO:0015629 GO:0017124 GO:0030046 GO:0030054 GO:0031941 GO:0032420 GO:0032421 GO:0032426 GO:0042995 GO:0043197 GO:0051015 GO:0051017 GO:0051491 GO:0051494 GO:0051639
5	0.06	0.281	5.03	0.09	0.47	4o1pC	GO:0000166 GO:0004540 GO:0004672 GO:0005524 GO:0006397 GO:0006468 GO:0046872 GO:0090501
6	0.06	0.364	4.98	0.04	0.58	5iwrA	GO:0005216 GO:0005227 GO:0005262 GO:0005516 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0006816 GO:0016020 GO:0016021 GO:0016324 GO:0055085 GO:0070509 GO:0070588
7	0.06	0.284	5.40	0.03	0.50	1n11A	GO:0005198 GO:0005200 GO:0005634 GO:0005737 GO:0005829 GO:0005856 GO:0005886 GO:0006887 GO:0006888 GO:0007010 GO:0007165 GO:0008093 GO:0010638 GO:0014731 GO:0016020 GO:0016323 GO:0016529 GO:0019899 GO:0030018 GO:0030507 GO:0030673 GO:0031430 GO:0031672 GO:0042383 GO:0043005 GO:0045199 GO:0045211 GO:0051117 GO:0072661
8	0.06	0.281	5.27	0.03	0.48	4oauC	GO:0000166 GO:0003723 GO:0004518 GO:0004519 GO:0004521 GO:0004540 GO:0004672 GO:0005524 GO:0005737 GO:0005739 GO:0005759 GO:0005829 GO:0006364 GO:0006397 GO:0006468 GO:0016363 GO:0016787 GO:0019843 GO:0043021 GO:0043488 GO:0045071 GO:0045444 GO:0045944 GO:0046872 GO:0051607 GO:0055085 GO:0060337 GO:0090501 GO:0090502 GO:2001275
9	0.06	0.315	5.22	0.03	0.55	3keaA
10	0.06	0.371	5.22	0.04	0.63	4rlvA	GO:0002027 GO:0003283 GO:0005200 GO:0005622 GO:0005737 GO:0005829 GO:0005856 GO:0005886 GO:0006874 GO:0006888 GO:0007165 GO:0007399 GO:0008093 GO:0010628 GO:0010881 GO:0010882 GO:0014704 GO:0016020 GO:0016323 GO:0016324 GO:0019899 GO:0019901 GO:0030018 GO:0030054 GO:0030315 GO:0030507 GO:0030674 GO:0030913 GO:0031430 GO:0031647 GO:0031672 GO:0033292 GO:0033365 GO:0034394 GO:0034613 GO:0036309 GO:0036371 GO:0042383 GO:0043005 GO:0043034 GO:0043268 GO:0044325 GO:0045121 GO:0045202 GO:0045211 GO:0050821 GO:0051117 GO:0051279 GO:0051597 GO:0051924 GO:0051928 GO:0055117 GO:0060307 GO:0070296 GO:0070972 GO:0072659 GO:0072661 GO:0086004 GO:0086005 GO:0086014 GO:0086015 GO:0086046 GO:0086066 GO:0086070 GO:0086091 GO:0098907 GO:0098910 GO:1901018 GO:1901019 GO:1901021 GO:2001259
11	0.06	0.218	5.39	0.06	0.39	4n5qB	GO:0005216 GO:0005261 GO:0005262 GO:0005887 GO:0006810 GO:0006811 GO:0006816 GO:0009266 GO:0009408 GO:0016020 GO:0016021 GO:0042636 GO:0043235 GO:0055085 GO:0070588 GO:0090280
12	0.06	0.210	5.42	0.06	0.37	1wg0A	GO:0005634 GO:0005829 GO:0005838 GO:0006508 GO:0070682
13	0.06	0.284	5.63	0.03	0.52	3t9kA	GO:0000082 GO:0001618 GO:0001669 GO:0001701 GO:0001708 GO:0001726 GO:0001894 GO:0001948 GO:0001968 GO:0002020 GO:0002042 GO:0003779 GO:0004872 GO:0005096 GO:0005102 GO:0005178 GO:0005518 GO:0005604 GO:0005737 GO:0005768 GO:0005886 GO:0005911 GO:0005912 GO:0005913 GO:0005925 GO:0006810 GO:0006874 GO:0006968 GO:0007155 GO:0007156 GO:0007159 GO:0007160 GO:0007161 GO:0007179 GO:0007229 GO:0008277 GO:0008284 GO:0008285 GO:0008305 GO:0008354 GO:0008542 GO:0009897 GO:0009986 GO:0010710 GO:0010811 GO:0010976 GO:0014704 GO:0014823 GO:0015026 GO:0015031 GO:0016020 GO:0016021 GO:0016032 GO:0016477 GO:0019900 GO:0019901 GO:0019904 GO:0019960 GO:0021943 GO:0030027 GO:0030054 GO:0030056 GO:0030175 GO:0030183 GO:0030198 GO:0030335 GO:0031175 GO:0031345 GO:0031410 GO:0031589 GO:0031594 GO:0031623 GO:0031667 GO:0032154 GO:0032403 GO:0032587 GO:0032594 GO:0033631 GO:0034113 GO:0034665 GO:0034666 GO:0034667 GO:0034677 GO:0034678 GO:0034679 GO:0034680 GO:0034681 GO:0034698 GO:0035024 GO:0035748 GO:0042277 GO:0042383 GO:0042470 GO:0042493 GO:0042995 GO:0043065 GO:0043149 GO:0043197 GO:0043235 GO:0043236 GO:0043410 GO:0043547 GO:0045121 GO:0045202 GO:0045214 GO:0045596 GO:0045665 GO:0045666 GO:0045807 GO:0046718 GO:0046872 GO:0046982 GO:0048333 GO:0048471 GO:0048675 GO:0048738 GO:0048813 GO:0050731 GO:0050776 GO:0050839 GO:0050900 GO:0050901 GO:0051393 GO:0051726 GO:0055007 GO:0055037 GO:0055038 GO:0060135 GO:0070062 GO:0070830 GO:0071260 GO:0071305 GO:0071404 GO:0071438 GO:0071479 GO:0071559 GO:0090004 GO:0097060 GO:0098639 GO:0098641 GO:2000811
14	0.06	0.304	5.58	0.07	0.57	4betA	GO:0005576 GO:0008152 GO:0009405 GO:0016740 GO:0030430 GO:0043087 GO:0044605
15	0.06	0.278	4.62	0.06	0.44	2fo1E	GO:0001708 GO:0002119 GO:0004888 GO:0005509 GO:0005634 GO:0005886 GO:0007219 GO:0007275 GO:0016020 GO:0016021 GO:0016324 GO:0018991 GO:0030154 GO:0040025 GO:0043054 GO:0045168
16	0.06	0.261	4.67	0.02	0.42	3b7bA	GO:0000122 GO:0002039 GO:0005634 GO:0005654 GO:0005694 GO:0006306 GO:0008168 GO:0008270 GO:0009790 GO:0016279 GO:0016568 GO:0016571 GO:0016740 GO:0018024 GO:0018026 GO:0018027 GO:0032259 GO:0034968 GO:0045892 GO:0046872 GO:0046974 GO:0046976 GO:0051567 GO:0060992 GO:0070734 GO:0070742 GO:1901796
17	0.06	0.240	4.90	0.05	0.39	2f8xK	GO:0000122 GO:0000139 GO:0001047 GO:0001190 GO:0001525 GO:0001669 GO:0001701 GO:0001708 GO:0001837 GO:0001889 GO:0001947 GO:0002040 GO:0002052 GO:0002193 GO:0002437 GO:0003157 GO:0003160 GO:0003162 GO:0003169 GO:0003180 GO:0003181 GO:0003184 GO:0003192 GO:0003197 GO:0003198 GO:0003203 GO:0003207 GO:0003208 GO:0003209 GO:0003213 GO:0003214 GO:0003219 GO:0003222 GO:0003241 GO:0003256 GO:0003264 GO:0003270 GO:0003273 GO:0003344 GO:0003682 GO:0003700 GO:0004857 GO:0004872 GO:0005112 GO:0005509 GO:0005576 GO:0005634 GO:0005654 GO:0005737 GO:0005783 GO:0005789 GO:0005794 GO:0005829 GO:0005886 GO:0005912 GO:0006351 GO:0006355 GO:0006357 GO:0006366 GO:0006367 GO:0006955 GO:0006959 GO:0007219 GO:0007221 GO:0007275 GO:0007283 GO:0007368 GO:0007386 GO:0007409 GO:0007420 GO:0007440 GO:0007492 GO:0007507 GO:0008284 GO:0008285 GO:0008544 GO:0008593 GO:0009912 GO:0009986 GO:0010001 GO:0010468 GO:0010718 GO:0010812 GO:0010832 GO:0014031 GO:0014807 GO:0016020 GO:0016021 GO:0016324 GO:0019899 GO:0021515 GO:0021915 GO:0030154 GO:0030182 GO:0030216 GO:0030279 GO:0030324 GO:0030326 GO:0030334 GO:0030335 GO:0030513 GO:0030514 GO:0030900 GO:0031069 GO:0031100 GO:0031410 GO:0031490 GO:0031960 GO:0032495 GO:0032496 GO:0035116 GO:0035148 GO:0035914 GO:0035924 GO:0042127 GO:0042246 GO:0043065 GO:0043086 GO:0043235 GO:0043565 GO:0045070 GO:0045165 GO:0045596 GO:0045603 GO:0045607 GO:0045608 GO:0045618 GO:0045662 GO:0045665 GO:0045668 GO:0045687 GO:0045747 GO:0045892 GO:0045893 GO:0045944 GO:0045955 GO:0046427 GO:0046533 GO:0046872 GO:0046982 GO:0048103 GO:0048663 GO:0048708 GO:0048709 GO:0048711 GO:0048715 GO:0048754 GO:0050434 GO:0050678 GO:0050679 GO:0050767 GO:0050768 GO:0050793 GO:0055008 GO:0060038 GO:0060045 GO:0060253 GO:0060271 GO:0060317 GO:0060411 GO:0060412 GO:0060528 GO:0060548 GO:0060740 GO:0060768 GO:0060842 GO:0060843 GO:0060948 GO:0060956 GO:0060979 GO:0060982 GO:0061314 GO:0061384 GO:0061419 GO:0070986 GO:0071372 GO:0071944 GO:0072017 GO:0072044 GO:0072144 GO:0072602 GO:0090051 GO:0090090 GO:0097150 GO:1901201 GO:1902263 GO:2000737 GO:2000811 GO:2000974 GO:2001027
18	0.06	0.311	5.17	0.05	0.53	4ot9A	GO:0000122 GO:0000978 GO:0001077 GO:0002268 GO:0002467 GO:0003677 GO:0003682 GO:0003700 GO:0003713 GO:0005634 GO:0005654 GO:0005737 GO:0005829 GO:0006351 GO:0006355 GO:0006357 GO:0006366 GO:0006954 GO:0007165 GO:0007249 GO:0007568 GO:0030198 GO:0032481 GO:0032496 GO:0033257 GO:0034097 GO:0038061 GO:0045087 GO:0045944 GO:0048511 GO:0048536 GO:0051092

Consensus prediction of GO terms

Molecular Function	GO:0015085	GO:0005261
GO-Score	0.50	0.50
Biological Processes	GO:0098662	GO:0006816	GO:0006950	GO:0009266
GO-Score	0.50	0.50	0.37	0.37
Cellular Component	GO:0031226
GO-Score	0.39

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.