I-TASSER results

Input Sequence in FASTA format

>protein (63 residues)
MLPTLSHIHAWDTEHLIEAAYYWTKVADQWEDVFLEMRNRSHFIAWEGAGGDGCDSEPAL
TYR

Predicted Secondary Structure

Sequence	20 40 60 \| \| \| MLPTLSHIHAWDTEHLIEAAYYWTKVADQWEDVFLEMRNRSHFIAWEGAGGDGCDSEPALTYR
Prediction	CCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEHCCHHHHHHHHCCCCCC
Conf.Score	998878865588699999999999999999999999998576556456589999985577889
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 \| \| \| MLPTLSHIHAWDTEHLIEAAYYWTKVADQWEDVFLEMRNRSHFIAWEGAGGDGCDSEPALTYR
Prediction	744424414614352035125305631541340133035453424153523521464453448
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60

                   |                   |                   |

Sec.Str
Seq

CCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEHCCHHHHHHHHCCCCCC
MLPTLSHIHAWDTEHLIEAAYYWTKVADQWEDVFLEMRNRSHFIAWEGAGGDGCDSEPALTYR

4i0xA

0.18

0.14

0.78

1.02

dPPAS2

-------------DEVGALSKFAASLADQMRAGSNSLDRDSLFGVWKGSAADAYRSGWD-EMQ

2kuiA4

0.23

0.22

0.98

1.09

Env-PPAS

VMPDLSG-MFWVDAEPRLRALGWTGMLDKGADVDAGGSQHNRVVYQNPPAGTGVNRDGIITLR

4wj1A

0.16

0.97

0.76

MUSTER

WEAAARIIHSGDTQLSKYFRDQWRDYQSTLEGHGRHF--ANPAEGWAGAAAETCAEAQRRLST

4cjdA2

0.16

0.14

0.87

0.73

dPPAS

SLADLTGTVEENSEALVKTAEVVNDISADVKANTAAIRENKA------ATANGLETRLADA--

4i0xA

0.15

0.11

0.76

0.93

wdPPAS

-------------DEVGALSKFAASLADQMRAGSNSLDRDVQSLVWKGSAADAYRSG--DEMQ

3i9wA1

0.20

0.16

0.81

0.90

wMUSTER

MARQLSEASAWEAQNLTSAEKMWQAQGRMLTAQSLKINA----------LLQALREQTAIE--

2kdlA

0.16

0.13

0.79

0.91

wPPAS

LILNLKQAKEEAIKELVDAG-----TA---EKYIKLIANAK-TVEW--TLKDEIKTFTVTE--

4cjdA2

0.16

0.14

0.87

0.93

dPPAS2

SLADLTGTVEENSEALVKTAEVVNDISADVKANTAAIRENKA------ATANGLETRLADA--

2n8pA

0.13

0.11

0.84

0.96

PPAS

MAGFLKVVQLLAKYGSKAVQWAWAN-----KGKILDWLNAGQAIDW---VVSKIKQILGIK--

1vx7W1

0.17

0.14

0.86

0.95

Env-PPAS

TYEAARAIRRM---KLLEAKKYLNDVIEKKRCVP--FRKYNGGVGRTNQ----AKEFNHTQGR

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-2.14

Estimated TM-score = 0.46±0.15

Estimated RMSD = 7.5±4.3Å

Download Model 2

C-score=-2.56

Download Model 3

C-score=-3.18

Download Model 4

C-score=-3.27

Download Model 5

C-score=-1.96

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	1uruA	0.841	1.78	0.079	0.968
2	5azoA	0.831	1.81	0.079	1.000
3	1f5nA2	0.808	1.70	0.049	0.968
4	4om2A	0.801	1.62	0.050	0.952
5	1cz7D	0.795	2.11	0.048	0.984
6	4g2kA	0.793	2.11	0.081	0.968
7	4uy3A	0.791	2.11	0.111	1.000
8	3kbuB	0.787	2.08	0.111	0.984
9	3sogA	0.785	2.16	0.095	1.000
10	3zciA	0.784	1.96	0.016	0.984

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.11	125	4bpmA	LVJ	Rep, Mult	15,16,19,20,22,23,24
2	0.09	102	1i94T	MG	Rep, Mult	11,12,13,14,15,16
3	0.07	80	3mnnG	MML	Rep, Mult	28,31,32
4	0.07	84	2q7rA	3CS	Rep, Mult	19,20,22,23,24,26
5	0.06	73	4f4sL	EFO	Rep, Mult	19,22,23,26,27,30
6	0.06	72	4i7zF	OZ2	Rep, Mult	15,16,19,20
7	0.05	61	1dgcA	NUC	Rep, Mult	2,5,6,9,10,13
8	0.05	60	2dyrB	TGL	Rep, Mult	30,33,34,37,38
9	0.05	57	3wmoE	BCL	Rep, Mult	22,23,26,27,30,31,58
10	0.02	30	3eymB	EYK	Rep, Mult	14,17,18
11	0.00	1	1h6gA	CA	Rep, Mult	32,52
12	0.00	1	2w6dB	CPL	Rep, Mult	41,53,54,57
13	0.00	3	2xcrS	RXV	Rep, Mult	38,42,45,52
14	0.00	1	2yl4A	14Y	Rep, Mult	37,40,41,44,50
15	0.00	2	3d6aA	MG	Rep, Mult	4,5
16	0.00	1	1e1cB	DCA	Rep, Mult	37,40

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.359	3brtA	0.525	1.29	0.051	0.619	2.7.11.10	16,20,24
2	0.284	1wt6B	0.652	1.38	0.075	0.746	2.7.11.1	14,16,27
3	0.226	2h8nA	0.654	1.64	0.019	0.746	3.5.1.98	36
4	0.225	3e7kH	0.651	1.72	0.019	0.762	2.7.11.1	22,29
5	0.217	3brvC	0.507	1.96	0.048	0.603	2.7.11.10	19
6	0.172	2jwaA	0.490	2.02	0.050	0.571	2.7.10.1	6
7	0.157	1xtcC	0.521	1.77	0.045	0.635	2.4.2.36	26
8	0.116	1k1fA	0.562	2.06	0.085	0.651	2.7.11.1	58
9	0.103	1qleD	0.522	0.94	0.054	0.571	1.9.3.1	NA
10	0.084	1ybzA	0.612	2.68	0.019	0.809	5.4.99.5	NA
11	0.066	1cxzB	0.661	2.41	0.048	0.873	2.7.11.13	45
12	0.060	2fenD	0.699	2.48	0.081	0.968	5.5.1.2	36
13	0.060	1c3cA	0.723	2.20	0.065	0.936	4.3.2.2	NA
14	0.060	1no3A	0.718	2.07	0.065	0.984	1.13.11.12	NA
15	0.060	1bucB	0.674	2.41	0.050	0.952	1.3.99.2	38,60
16	0.060	2zr3B	0.699	2.36	0.050	0.952	6.1.1.11	NA
17	0.060	2uz5A	0.398	3.01	0.071	0.619	5.2.1.8	50,53
18	0.060	1dcnB	0.685	2.56	0.063	0.968	4.3.2.1	NA
19	0.060	1q5nA	0.682	2.80	0.079	0.984	5.5.1.2	NA
20	0.060	1y2mB	0.685	2.55	0.100	0.952	4.3.1.24	NA
21	0.060	3d3lA	0.708	2.18	0.016	0.952	1.13.11.31	NA
22	0.060	1yisA	0.713	2.62	0.095	0.968	4.3.2.2	NA
23	0.060	2inrA	0.691	2.54	0.032	0.952	5.99.1.-	NA
24	0.060	1bucA	0.677	2.81	0.048	0.984	1.3.99.2	NA
25	0.060	2iukA	0.731	1.98	0.048	0.984	1.13.11.12	NA
26	0.060	1w27A	0.743	2.03	0.066	0.968	4.3.1.24	NA
27	0.060	2b5uA	0.751	2.46	0.063	1.000	3.1.-.-	NA
28	0.060	1jqiA	0.686	2.72	0.032	0.984	1.3.99.2	NA
29	0.060	3dy5A	0.711	2.38	0.000	0.984	1.13.11.40,4.2.1.92	NA
30	0.060	1rx0A	0.699	2.29	0.033	0.952	1.3.99.-	57

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.18	0.773	2.00	0.13	1.00	1uruA	GO:0005543 GO:0005737 GO:0005829 GO:0005886 GO:0006887 GO:0006897 GO:0006937 GO:0007269 GO:0008104 GO:0032154 GO:0042052 GO:0045202 GO:0045313 GO:0048488 GO:0098793
1	0.17	0.814	1.54	0.03	0.95	4om3D	GO:0000122 GO:0001106 GO:0005634 GO:0005654 GO:0005730 GO:0005737 GO:0005829 GO:0006351 GO:0006355 GO:0007165 GO:0007275 GO:0008134 GO:0009887 GO:0010628 GO:0016055 GO:0030178 GO:0042802 GO:0043124 GO:0045892 GO:1904837 GO:2000811
2	0.16	0.765	2.23	0.10	1.00	4atmA	GO:0005086 GO:0005543 GO:0005737 GO:0005802 GO:0005856 GO:0006897 GO:0007268 GO:0008021 GO:0015629 GO:0016020 GO:0030054 GO:0030672 GO:0031256 GO:0031410 GO:0043547 GO:0045202
3	0.15	0.795	2.11	0.05	0.98	1cz7D	GO:0000022 GO:0000166 GO:0000212 GO:0001578 GO:0003777 GO:0005524 GO:0005634 GO:0005737 GO:0005813 GO:0005819 GO:0005829 GO:0005856 GO:0005871 GO:0005872 GO:0005874 GO:0007018 GO:0007049 GO:0007051 GO:0007052 GO:0007056 GO:0007059 GO:0007067 GO:0007100 GO:0008017 GO:0008569 GO:0016887 GO:0030981 GO:0031534 GO:0032837 GO:0032888 GO:0042803 GO:0048471 GO:0051028 GO:0051297 GO:0051298 GO:0051301 GO:0051321 GO:0072687 GO:0090306 GO:0090307 GO:1901673 GO:1990498
4	0.14	0.808	1.70	0.05	0.97	1f5nA	GO:0000139 GO:0000166 GO:0002376 GO:0003779 GO:0003924 GO:0005525 GO:0005576 GO:0005737 GO:0005794 GO:0005829 GO:0005886 GO:0016020 GO:0016787 GO:0019899 GO:0019955 GO:0030507 GO:0042802 GO:0050848 GO:0050860 GO:0051607 GO:0051879 GO:0060333 GO:0070373 GO:1900025 GO:1900041 GO:1903076 GO:1903077
5	0.12	0.770	2.04	0.08	1.00	4avmA	GO:0001891 GO:0002102 GO:0005543 GO:0005737 GO:0005886 GO:0005938 GO:0006911 GO:0016020 GO:0030054 GO:0042995 GO:0060326 GO:0071800 GO:0097320
6	0.12	0.734	2.38	0.07	0.94	3u06B	GO:0000022 GO:0000166 GO:0000212 GO:0001578 GO:0003777 GO:0005524 GO:0005634 GO:0005737 GO:0005813 GO:0005819 GO:0005829 GO:0005856 GO:0005871 GO:0005872 GO:0005874 GO:0007018 GO:0007049 GO:0007051 GO:0007052 GO:0007056 GO:0007059 GO:0007067 GO:0007100 GO:0008017 GO:0008569 GO:0016887 GO:0030981 GO:0031534 GO:0032837 GO:0032888 GO:0042803 GO:0048471 GO:0051028 GO:0051297 GO:0051298 GO:0051301 GO:0051321 GO:0072687 GO:0090306 GO:0090307 GO:1901673 GO:1990498
7	0.11	0.672	2.62	0.08	0.98	5ca9A	GO:0000166 GO:0003924 GO:0005525 GO:0005783 GO:0005789 GO:0007029 GO:0008645 GO:0009405 GO:0016020 GO:0016021 GO:0016787 GO:0035690
8	0.10	0.799	2.08	0.05	1.00	1dg3A	GO:0000139 GO:0000166 GO:0002376 GO:0003779 GO:0003924 GO:0005525 GO:0005576 GO:0005737 GO:0005794 GO:0005829 GO:0005886 GO:0016020 GO:0016787 GO:0019899 GO:0019955 GO:0030507 GO:0042802 GO:0050848 GO:0050860 GO:0051607 GO:0051879 GO:0060333 GO:0070373 GO:1900025 GO:1900041 GO:1903076 GO:1903077
9	0.10	0.601	2.10	0.10	0.78	1jq0A	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
10	0.09	0.770	2.06	0.10	1.00	2ficB	GO:0005634 GO:0005737 GO:0006897 GO:0006997 GO:0007275 GO:0008283 GO:0015629 GO:0016020 GO:0016032 GO:0030018 GO:0030100 GO:0030154 GO:0030315 GO:0030424 GO:0031674 GO:0033268 GO:0042692 GO:0042802 GO:0043065 GO:0043194 GO:0045664 GO:0048156 GO:0048711 GO:0051015 GO:0060987 GO:0060988 GO:0070063 GO:0071156
11	0.08	0.639	2.83	0.02	0.95	4etpA	GO:0000166 GO:0000741 GO:0000742 GO:0000743 GO:0003777 GO:0005524 GO:0005634 GO:0005737 GO:0005816 GO:0005856 GO:0005874 GO:0005881 GO:0007018 GO:0007049 GO:0007064 GO:0007067 GO:0007126 GO:0008017 GO:0008569 GO:0046982 GO:0051301 GO:0060236
12	0.07	0.671	0.73	0.09	0.71	3k9aA
13	0.07	0.702	2.38	0.05	0.90	2i1jA	GO:0003779 GO:0005737 GO:0005856 GO:0008092 GO:0019898
14	0.07	0.730	2.06	0.10	0.94	3wfvA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
15	0.07	0.554	3.60	0.05	0.92	4idnB	GO:0000137 GO:0000139 GO:0000166 GO:0003924 GO:0005525 GO:0005737 GO:0005783 GO:0005789 GO:0005794 GO:0007029 GO:0007409 GO:0016020 GO:0016021 GO:0016787 GO:0030424 GO:0042802 GO:0042995 GO:0051260
16	0.07	0.715	2.11	0.04	0.86	1qbzA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
17	0.07	0.722	2.12	0.05	0.98	1envA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0002223 GO:0003677 GO:0003682 GO:0003700 GO:0005198 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0019064 GO:0019082 GO:0020002 GO:0030683 GO:0033644 GO:0039654 GO:0039663 GO:0042802 GO:0043565 GO:0044174 GO:0044175 GO:0045899 GO:0046718 GO:0055036 GO:0060261 GO:0075509 GO:0075512 GO:1903833
18	0.07	0.498	2.59	0.08	0.63	4ozqB	GO:0000166 GO:0001558 GO:0003777 GO:0005524 GO:0005634 GO:0005737 GO:0005819 GO:0005856 GO:0005874 GO:0005886 GO:0007018 GO:0007019 GO:0007080 GO:0008017 GO:0008284 GO:0008574 GO:0010389 GO:0015631 GO:0016020 GO:0016887 GO:0019901 GO:0021685 GO:0021693 GO:0021695 GO:0021766 GO:0021772 GO:0021846 GO:0021987 GO:0030155 GO:0030165 GO:0030334 GO:0030496 GO:0031146 GO:0031641 GO:0032147 GO:0032467 GO:0032487 GO:0033624 GO:0034446 GO:0043066 GO:0043161 GO:0043523 GO:0043524 GO:0045184 GO:0051233 GO:0051301 GO:1902519 GO:1903047 GO:1903429 GO:2000045
19	0.07	0.492	2.21	0.02	0.65	3b6vA	GO:0000166 GO:0003774 GO:0003777 GO:0005524 GO:0005737 GO:0005829 GO:0005856 GO:0005871 GO:0005874 GO:0006890 GO:0007018 GO:0008017 GO:0016887 GO:0019886 GO:0072372 GO:0072384 GO:0097542
20	0.07	0.414	3.00	0.04	0.60	4b2th	GO:0000166 GO:0005524 GO:0005737 GO:0005832 GO:0006457 GO:0051082
21	0.07	0.489	3.21	0.05	0.71	2owmA	GO:0000166 GO:0003777 GO:0005524 GO:0005874 GO:0007018 GO:0008017 GO:0072383
22	0.07	0.479	2.74	0.04	0.68	3cnzA	GO:0000166 GO:0003777 GO:0003824 GO:0005524 GO:0005856 GO:0007018 GO:0008017 GO:0016491 GO:0055114
23	0.07	0.508	2.06	0.02	0.67	3dcbA	GO:0000166 GO:0003777 GO:0005524 GO:0005737 GO:0005856 GO:0005871 GO:0005874 GO:0007018 GO:0007052 GO:0007057 GO:0007143 GO:0008017 GO:0016887 GO:0031116 GO:0032837 GO:0045132 GO:0051010 GO:0051296

Consensus prediction of GO terms

Molecular Function	GO:0005515	GO:1901265	GO:0036094	GO:0001191	GO:0003714	GO:0001104	GO:0005085	GO:0005543
GO-Score	0.58	0.54	0.54	0.35	0.35	0.35	0.31	0.31
Biological Processes	GO:0099643	GO:0036465	GO:0006936	GO:0042052	GO:0072583	GO:0001505	GO:0090257	GO:0099531	GO:0044091	GO:0033036	GO:0006836	GO:0043122	GO:0006357	GO:0010604	GO:0045892	GO:0006461	GO:0043066	GO:0030111	GO:2000209	GO:1902532	GO:0051345	GO:0043087
GO-Score	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.36	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.35	0.31	0.31
Cellular Component	GO:0043232	GO:0005829	GO:0097610	GO:0032155	GO:0031981	GO:0099501	GO:0044459	GO:0098791	GO:0008021	GO:0031252
GO-Score	0.56	0.51	0.36	0.36	0.35	0.31	0.31	0.31	0.31	0.31

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv1950c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]