I-TASSER results

Input Sequence in FASTA format

>protein (99 residues)
MSFVTTQPEALAAAAGSLQGIGSALNAQNAAAATPTTGVVPAAADEVSALTAAQFAAHAQ
IYQAVSAQAAAIHEMFVNTLQMSSGSYAATEAANAAAAG

Predicted Secondary Structure

Sequence	20 40 60 80 \| \| \| \| MSFVTTQPEALAAAAGSLQGIGSALNAQNAAAATPTTGVVPAAADEVSALTAAQFAAHAQIYQAVSAQAAAIHEMFVNTLQMSSGSYAATEAANAAAAG
Prediction	CCEEEHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Conf.Score	976764579999999999999889999887777776445677776789999999999999999999999999999999999989999999999886569
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 \| \| \| \| MSFVTTQPEALAAAAGSLQGIGSALNAQNAAAATPTTGVVPAAADEVSALTAAQFAAHAQIYQAVSAQAAAIHEMFVNTLQMSSGSYAATEAANAAAAG
Prediction	743342324303311431451333143343303333342443344301220032034225403412341331042024203433432231123234658
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80

                   |                   |                   |                   |

Sec.Str
Seq

CCEEEHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
MSFVTTQPEALAAAAGSLQGIGSALNAQNAAAATPTTGVVPAAADEVSALTAAQFAAHAQIYQAVSAQAAAIHEMFVNTLQMSSGSYAATEAANAAAAG

2g38C

0.36

0.27

0.77

1.26

MUSTER

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.36

0.27

0.77

1.25

dPPAS

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.36

0.27

0.77

2.53

wdPPAS

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.36

0.27

0.77

1.67

wMUSTER

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.36

0.27

0.77

2.39

wPPAS

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.36

0.27

0.77

2.28

dPPAS2

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.36

0.27

0.77

1.49

PPAS

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

2g38C

0.36

0.27

0.77

1.56

Env-PPAS

-------PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTG----------------

1wa8B

0.15

0.14

0.95

0.98

MUSTER

MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGS-----SEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA

3zbhA

0.14

0.13

0.91

0.82

dPPAS

-----LTPEELRGVARQYNVESSNVTELIARLDQMSHTLQGIWEG----ASSEAFIQQYQELRPSFEKMAVLLNEVGQQLHNSATILEDTDQQIASQIR

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=0.14

Estimated TM-score = 0.73±0.11

Estimated RMSD = 3.7±2.5Å

Download Model 2

C-score=-2.21

Download Model 3

C-score=-5.00

Download Model 4

C-score=-5.00

Download Model 5

C-score=-5.00

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	1ciiA	0.808	2.01	0.121	0.960
2	1qu7A	0.803	1.96	0.092	0.950
3	2v0oA	0.797	2.12	0.051	0.950
4	4nqiA	0.794	2.15	0.071	0.960
5	3g67A	0.790	1.94	0.093	0.939
6	3gvmA	0.777	2.06	0.161	0.939
7	4wheA	0.770	2.31	0.073	0.960
8	2efkA	0.768	2.17	0.082	0.929
9	3na7A1	0.765	2.32	0.051	0.950
10	2ch7A	0.763	2.22	0.040	0.960

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.11	31	2h7hB	NUC	Rep, Mult	51,52,55,56,58,59,62,63
2	0.10	29	2dgcA	NUC	Rep, Mult	49,52,53,56,57,60,64
3	0.10	27	3ak9I	FE2	Rep, Mult	29,63,67
4	0.07	16	2axtC	UNK	Rep, Mult	18,72,73,76
5	0.05	15	2wt7B	NUC	Rep, Mult	55,56,60,63,64,67
6	0.03	9	1gu5B	NUC	Rep, Mult	54,55,58,59,61,62,63,65
7	0.03	10	1nf4C	FEC	Rep, Mult	15,22,23,26,30,67,74,75,78
8	0.03	8	4mbeE	III	Rep, Mult	59,62,63,66,67,69,70,73
9	0.03	8	3j7y8	NUC	Rep, Mult	59,62,63,66,70
10	0.02	7	1a02F	NUC	Rep, Mult	52,53,56,57,59,60,63,64
11	0.02	6	3fyiA	DMU	Rep, Mult	8,10,80,84,87
12	0.01	2	1xveD	3BB	Rep, Mult	21,25,28
13	0.00	1	1xrmA	III	Rep, Mult	77,80
14	0.00	1	2g380	III	Rep, Mult	10,17,21,24,28,32,36,38,39,40,41,42,43,44,45,46,47,48,51,54,55,58,59,62,65,68,69,72,73,76,80
15	0.00	1	2jj1G	PIT	Rep, Mult	83,86,87,90,91

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.403	2w5jA	0.502	2.65	0.080	0.697	3.6.3.14	74
2	0.212	3e7kH	0.484	1.55	0.071	0.545	2.7.11.1	NA
3	0.186	1wt6B	0.513	1.13	0.109	0.556	2.7.11.1	27
4	0.170	1wu0A	0.500	2.56	0.043	0.687	3.6.3.14	NA
5	0.164	1urfA	0.555	2.54	0.065	0.717	2.7.11.13	NA
6	0.155	1joyA	0.464	2.41	0.131	0.596	2.7.13.3	25,72
7	0.152	1vp7B	0.494	2.71	0.067	0.646	3.1.11.6	27,59,67
8	0.150	2h8nA	0.524	1.37	0.106	0.566	3.5.1.98	67
9	0.143	1cxzB	0.564	2.59	0.000	0.737	2.7.11.13	25
10	0.060	2pfdB	0.620	2.69	0.061	0.849	2.1.2.5,4.3.1.4	NA
11	0.060	1dcnB	0.653	2.71	0.053	0.838	4.3.2.1	74
12	0.060	1y2mB	0.592	3.56	0.084	0.879	4.3.1.24	NA
13	0.060	1yfeA	0.607	3.49	0.052	0.939	4.2.1.2	NA
14	0.060	1p49A	0.588	4.04	0.072	0.950	3.1.6.2	NA
15	0.060	2fonB	0.653	3.30	0.093	0.889	1.3.3.6	NA
16	0.060	2rnpC	0.578	3.13	0.044	0.818	2.7.7.6	NA
17	0.060	2zr3B	0.611	3.07	0.020	0.869	6.1.1.11	22,28,64
18	0.060	3g61A	0.709	2.95	0.063	0.960	3.6.3.44	NA
19	0.060	2e9fB	0.622	2.79	0.131	0.828	4.3.2.1	NA
20	0.060	3i39X	0.617	2.39	0.082	0.748	1.2.99.2	NA
21	0.060	1jqkF	0.606	2.65	0.061	0.758	1.2.99.2	86
22	0.060	1k62B	0.657	2.48	0.021	0.828	4.3.2.1	NA
23	0.060	1w07B	0.642	3.24	0.093	0.889	1.3.3.6	NA
24	0.060	1eiyA	0.594	2.63	0.084	0.778	6.1.1.20	NA
25	0.060	1c3cA	0.658	2.87	0.068	0.838	4.3.2.2	NA
26	0.060	1jswB	0.661	2.98	0.079	0.859	4.3.1.1	NA
27	0.060	1mswD	0.474	3.05	0.108	0.687	2.7.7.6	NA
28	0.060	1u7lA	0.619	3.26	0.104	0.950	3.6.3.14	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.40	0.820	0.83	0.35	0.86	4kxrA	GO:0005576 GO:0009405
1	0.29	0.463	0.59	0.06	0.47	3he5A
2	0.27	0.790	1.94	0.09	0.94	3g67A	GO:0004871 GO:0007165 GO:0016020
3	0.26	0.742	2.53	0.14	0.97	3zx6A	GO:0004871 GO:0004888 GO:0005886 GO:0005887 GO:0006935 GO:0007165 GO:0016020 GO:0016021 GO:0043200 GO:0043424 GO:0046872 GO:0048870
4	0.23	0.469	1.83	0.07	0.54	2x7rC	GO:0002223 GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0019064 GO:0019082 GO:0020002 GO:0030683 GO:0033644 GO:0039654 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036 GO:0075509 GO:0075512
5	0.22	0.485	1.73	0.04	0.56	1dh3A	GO:0000785 GO:0000790 GO:0000975 GO:0000978 GO:0000980 GO:0001102 GO:0001190 GO:0001666 GO:0003677 GO:0003690 GO:0003700 GO:0003705 GO:0005634 GO:0005654 GO:0005667 GO:0005719 GO:0005739 GO:0005759 GO:0006351 GO:0006355 GO:0006366 GO:0006468 GO:0007179 GO:0007219 GO:0007409 GO:0007568 GO:0007595 GO:0007613 GO:0007623 GO:0008134 GO:0008361 GO:0008542 GO:0010033 GO:0010629 GO:0010944 GO:0014823 GO:0019899 GO:0021983 GO:0030154 GO:0030424 GO:0030544 GO:0030879 GO:0032916 GO:0033363 GO:0033762 GO:0034670 GO:0035035 GO:0035094 GO:0035497 GO:0035729 GO:0036120 GO:0036276 GO:0040018 GO:0042493 GO:0042752 GO:0042802 GO:0042981 GO:0043065 GO:0043565 GO:0044212 GO:0045600 GO:0045672 GO:0045893 GO:0045899 GO:0045944 GO:0046887 GO:0046889 GO:0048145 GO:0048511 GO:0050821 GO:0055025 GO:0060251 GO:0060428 GO:0060430 GO:0060509 GO:0071294 GO:0071363 GO:0071398 GO:0071560 GO:1900273 GO:1901215 GO:1902065 GO:1990090 GO:1990314 GO:1990589 GO:1990763
6	0.21	0.657	2.75	0.08	0.92	4nqiD	GO:0000281 GO:0000331 GO:0001891 GO:0005885 GO:0005905 GO:0006909 GO:0007009 GO:0009992 GO:0010324 GO:0031150 GO:0035091 GO:0042803 GO:0045335 GO:0046847 GO:0071476 GO:0072583
7	0.21	0.787	2.15	0.08	0.95	2efkA	GO:0001891 GO:0005086 GO:0005096 GO:0005654 GO:0005737 GO:0005764 GO:0005794 GO:0005802 GO:0005829 GO:0005856 GO:0005886 GO:0005938 GO:0006897 GO:0007154 GO:0007165 GO:0008289 GO:0016020 GO:0016192 GO:0030036 GO:0042802 GO:0042995 GO:0043231 GO:0043547 GO:0048471 GO:0051056 GO:0070062
8	0.20	0.701	2.08	0.04	0.85	4bneA	GO:0005737 GO:0005768 GO:0005769 GO:0005802 GO:0005829 GO:0005856 GO:0005886 GO:0005901 GO:0005925 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0030036 GO:0030054 GO:0030100 GO:0030659 GO:0031410 GO:0032587 GO:0042995 GO:0045806 GO:0055038 GO:0070300 GO:0070836 GO:0097320
9	0.20	0.689	2.05	0.09	0.84	3i2wB	GO:0000281 GO:0005543 GO:0005768 GO:0005829 GO:0005886 GO:0007053 GO:0007112 GO:0007269 GO:0008289 GO:0030100 GO:0030496 GO:0032154 GO:0036090 GO:0045211 GO:0045887 GO:0048488 GO:0061024 GO:0071212
10	0.19	0.797	2.12	0.05	0.95	2v0oA	GO:0001786 GO:0005546 GO:0005886 GO:0005905 GO:0006897 GO:0010324 GO:0016020 GO:0030136 GO:0035091 GO:0048268 GO:0072583 GO:0072659
11	0.18	0.510	2.63	0.07	0.70	3cp1A	GO:0005198 GO:0019031
12	0.18	0.566	2.86	0.04	0.76	3k9aA
13	0.17	0.763	2.22	0.04	0.96	2ch7A	GO:0004871 GO:0005886 GO:0006935 GO:0007165 GO:0016020 GO:0016021
14	0.17	0.695	1.99	0.09	0.84	3i2wA	GO:0000281 GO:0005543 GO:0005768 GO:0005829 GO:0005886 GO:0007053 GO:0007112 GO:0007269 GO:0008289 GO:0030100 GO:0030496 GO:0032154 GO:0036090 GO:0045211 GO:0045887 GO:0048488 GO:0061024 GO:0071212
15	0.16	0.620	2.70	0.07	0.85	1qbzA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
16	0.16	0.751	2.39	0.07	0.95	2eflA	GO:0005086 GO:0005737 GO:0005764 GO:0005802 GO:0005856 GO:0005886 GO:0005905 GO:0005938 GO:0006897 GO:0008289 GO:0016020 GO:0016023 GO:0016192 GO:0031410 GO:0042802 GO:0043547
17	0.16	0.745	2.80	0.09	0.96	3syvC	GO:0005654 GO:0005737 GO:0005768 GO:0005802 GO:0005886 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019855 GO:0045806 GO:0051044 GO:0051926 GO:0070062 GO:0097320
18	0.15	0.750	2.33	0.05	0.95	5c1fA	GO:0001786 GO:0005547 GO:0005737 GO:0005826 GO:0005829 GO:0005856 GO:0007049 GO:0007067 GO:0051301 GO:0070273 GO:1903475
19	0.14	0.599	2.60	0.04	0.77	3p30A
20	0.14	0.561	3.68	0.06	0.90	3q0kD	GO:0005215 GO:0005654 GO:0005737 GO:0005768 GO:0005769 GO:0005829 GO:0005856 GO:0005886 GO:0005901 GO:0005911 GO:0005913 GO:0005925 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019898 GO:0030036 GO:0030100 GO:0030659 GO:0031410 GO:0032587 GO:0036010 GO:0042802 GO:0042995 GO:0043231 GO:0045806 GO:0048858 GO:0055038 GO:0070062 GO:0070300 GO:0070836 GO:0072584 GO:0097320 GO:0098609 GO:0098641
21	0.13	0.691	2.75	0.03	0.93	2d1lA	GO:0001701 GO:0002230 GO:0003779 GO:0003785 GO:0005102 GO:0005737 GO:0005856 GO:0005912 GO:0007009 GO:0007015 GO:0007399 GO:0007517 GO:0010960 GO:0015629 GO:0030036 GO:0030041 GO:0030282 GO:0032233 GO:0034334 GO:0042802 GO:0050680 GO:0051015 GO:0061333 GO:0071498 GO:0072001 GO:0072102 GO:0072160 GO:0098792 GO:2001013
22	0.12	0.636	2.20	0.06	0.81	3wfvA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
23	0.11	0.665	2.74	0.10	0.91	3qniA	GO:0005543 GO:0005737 GO:0005768 GO:0005829 GO:0005886 GO:0006897 GO:0007015 GO:0008092 GO:0008289 GO:0016020 GO:0030054 GO:0030100 GO:0030137 GO:0030659 GO:0031410 GO:0032587 GO:0042995 GO:0043005 GO:0043209 GO:0043679 GO:0045202 GO:0045806 GO:0048471 GO:0048488 GO:0048666 GO:0048812 GO:0072657 GO:0090002 GO:0097320 GO:1900006
24	0.11	0.615	3.09	0.07	0.89	3haiA	GO:0005543 GO:0005737 GO:0005768 GO:0005829 GO:0005886 GO:0006897 GO:0007015 GO:0008092 GO:0008289 GO:0016020 GO:0030054 GO:0030100 GO:0030137 GO:0030659 GO:0031410 GO:0032587 GO:0042995 GO:0043005 GO:0043209 GO:0043679 GO:0045202 GO:0045806 GO:0048471 GO:0048488 GO:0048666 GO:0048812 GO:0072657 GO:0090002 GO:0097320 GO:1900006
25	0.10	0.743	2.30	0.09	0.95	1y2oA	GO:0001726 GO:0005737 GO:0005829 GO:0005856 GO:0005886 GO:0005913 GO:0007009 GO:0007409 GO:0008022 GO:0008093 GO:0008286 GO:0008360 GO:0009617 GO:0014069 GO:0015629 GO:0016020 GO:0016358 GO:0030141 GO:0030165 GO:0030175 GO:0030838 GO:0032956 GO:0038096 GO:0042802 GO:0042995 GO:0043005 GO:0043025 GO:0043197 GO:0048010 GO:0048167 GO:0051017 GO:0051764 GO:0061003 GO:0070062 GO:0070064 GO:0097481 GO:0098609 GO:0098641 GO:2000251
26	0.10	0.595	3.35	0.06	0.88	3syvB	GO:0005654 GO:0005737 GO:0005768 GO:0005802 GO:0005886 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019855 GO:0045806 GO:0051044 GO:0051926 GO:0070062 GO:0097320
27	0.09	0.663	2.70	0.13	0.92	3m3wB	GO:0005654 GO:0005737 GO:0005768 GO:0005802 GO:0005886 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019855 GO:0045806 GO:0051044 GO:0051926 GO:0070062 GO:0097320
28	0.08	0.604	3.06	0.06	0.86	2ezoA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036

Consensus prediction of GO terms

Molecular Function	GO:0043169	GO:0019901	GO:0099600	GO:0038023
GO-Score	0.53	0.53	0.53	0.53
Biological Processes	GO:0001101	GO:0010243	GO:1901700	GO:0006928	GO:0051674	GO:0042330	GO:0002220	GO:0050690	GO:0020012	GO:0019065	GO:0039663	GO:0050687	GO:0016485	GO:0019080	GO:0019049	GO:0044650	GO:0072583	GO:0009405
GO-Score	0.53	0.53	0.53	0.53	0.53	0.53	0.46	0.46	0.46	0.46	0.46	0.46	0.46	0.46	0.46	0.46	0.46	0.40
Cellular Component	GO:0031226	GO:0036338	GO:0044174	GO:0033644	GO:0016021	GO:0005576
GO-Score	0.53	0.46	0.46	0.46	0.43	0.40

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv1788

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]