I-TASSER results

Input Sequence in FASTA format

>protein (199 residues)
MSDHKVPFNRPYMTGRELAYIAEAHSCGHLAGDGPFTRRSHAWLEQQTGCRKALLTPSCT
AALEMMALLLDIEEGDEVILPSYTFVSTANAFVLRGGVPVFVDIRPDTLNIDETRIVDAI
TPRTKAIVPVHYAGVACEMDAIMKIATHHNLAVVEDAAQGAMASYRGRALGSIGDLGALS
FHETKNVISGEGGALLVNS

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 180 \| \| \| \| \| \| \| \| \| MSDHKVPFNRPYMTGRELAYIAEAHSCGHLAGDGPFTRRSHAWLEQQTGCRKALLTPSCTAALEMMALLLDIEEGDEVILPSYTFVSTANAFVLRGGVPVFVDIRPDTLNIDETRIVDAITPRTKAIVPVHYAGVACEMDAIMKIATHHNLAVVEDAAQGAMASYRGRALGSIGDLGALSFHETKNVISGEGGALLVNS
Prediction	CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCEEEEHCCHHHHHHHHHHHHCCCCCCEEEHCCCCHHHHHHHHHHHCCEEEEEHCCCCCCCCCHHHHHHHCCCCCCEEEEHCCCCCCCCHHHHHHHHHHHCCCEEEHCCCCCCCEHCCEHCCCCCCEEEHCCCCCCCEHCCCCEEEEHCC
Conf.Score	9998866779999999999999999989866898779999999999989995898678889999999998999998898689974687899998799899997578888999999999868888589985688876777999999999899599877864687668976786544578657898655547876899889
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 180 \| \| \| \| \| \| \| \| \| MSDHKVPFNRPYMTGRELAYIAEAHSCGHLAGDGPFTRRSHAWLEQQTGCRKALLTPSCTAALEMMALLLDIEEGDEVILPSYTFVSTANAFVLRGGVPVFVDIRPDTLNIDETRIVDAITPRTKAIVPVHYAGVACEMDAIMKIATHHNLAVVEDAAQGAMASYRGRALGSIGDLGALSFHETKNVISGEGGALLVNS
Prediction	8676403003141475016003400624210442630450053017216042000000000000000201704540002003310100000022340300000034602301162027203741200000010010041430250067260200000000210424433000202000000234130001100000038
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160                 180

                   |                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCEEEEHCCHHHHHHHHHHHHCCCCCCEEEHCCCCHHHHHHHHHHHCCEEEEEHCCCCCCCCCHHHHHHHCCCCCCEEEEHCCCCCCCCHHHHHHHHHHHCCCEEEHCCCCCCCEHCCEHCCCCCCEEEHCCCCCCCEHCCCCEEEEHCC
MSDHKVPFNRPYMTGRELAYIAEAHSCGHLAGDGPFTRRSHAWLEQQTGCRKALLTPSCTAALEMMALLLDIEEGDEVILPSYTFVSTANAFVLRGGVPVFVDIRPDTLNIDETRIVDAITPRTKAIVPVHYAGVACEMDAIMKIATHHNLAVVEDAAQGAMASYRGRALGSIGDLGALSFHETKNVISGEGGALLVNS

4lc3A

0.39

0.98

3.86

MUSTER

--APFLPFTRPEIDEETIQGVVEVLRSGWIT-TGPQCQKFEAALSEYCGGRPVRVFNSGTCTLEIGLRIAGVGPGDEVITTPASWVSTSNVIIETGATPVFADIDPVTRNIDLDKLEQAITPRTKAIIPVFLSGLPVDMDRLYAIARAHKLRVIEDAAQAFGSTWHGKRIGAIGDLVSFSFHANKNLTTIEGGALVLNN

4k2bA1

0.39

0.32

0.81

7.27

dPPAS

---------------------------------GPYLEQFEKVLSTYLHKRYVIATSSGTDAIMIGLLALGLNPGDEVIMPANSFSATENAVLASGGVPIYVDINPQTFCIDPDKIEEAITPYTKFILPVHLYGKHSDMQHIRQIANRYKLKVIEDACQGIGLTD----LGKYADITTLSFNPYNFGVCGKAGAIATDN

4k2bA1

0.39

0.32

0.81

5.73

wdPPAS

---------------------------------GPYLEQFEKVLSTYLHKRYVIATSSGTDAIMIGLLALGLNPGDEVIMPANSFSATENAVLASGGVPIYVDINPQTFCIDPDKIEEAITPYTKFILPVHLYGKHSDMQHIRQIANRYKLKVIEDACQGIGLTD----LGKYADITTLSFNPYNFGVCGKAGAIATDN

4lc3A

0.40

0.39

0.97

4.28

wMUSTER

F----LPFTRPEIDEETIQGVVEVLRSGWIT-TGPQCQKFEAALSEYCGGRPVRVFNSGTCTLEIGLRIAGVGPGDEVITTPASWVSTSNVIIETGATPVFADIDPVTRNIDLDKLEQAITPRTKAIIPVFLSGLPVDMDRLYAIARAHKLRVIEDAAQAFGSTWHGKRIGAIGDLVSFSFHANKNLTTIEGGALVLNN

4k2bA1

0.38

0.31

0.81

4.20

wPPAS

---------------------------------GPYLEQFEKVLSTYLHKRYVIATSSGTDAIMIGLLALGLNPGDEVIMPANSFSATENAVLASGGVPIYVDINPQTFCIDPDKIEEAITPYTKFILPVHLYGKHSDMQHIRQIANRYKLKVIEDACQGIGLTDL----GKYADITTLSFNPYNFGVCGKAGAIATDN

4k2bA1

0.39

0.32

0.81

7.18

dPPAS2

---------------------------------GPYLEQFEKVLSTYLHKRYVIATSSGTDAIMIGLLALGLNPGDEVIMPANSFSATENAVLASGGVPIYVDINPQTFCIDPDKIEEAITPYTKFILPVHLYGKHSDMQHIRQIANRYKLKVIEDACQGIGLTD----LGKYADITTLSFNPYNFGVCGKAGAIATDN

4k2bA1

0.38

0.31

0.81

4.04

PPAS

---------------------------------GPYLEQFEKVLSTYLHKRYVIATSSGTDAIMIGLLALGLNPGDEVIMPANSFSATENAVLASGGVPIYVDINPQTFCIDPDKIEEAITPYTKFILPVHLYGKHSDMQHIRQIANRYKLKVIEDACQGIGLTDL----GKYADITTLSFNPYNFGVCGKAGAIATDN

4k2bA1

0.39

0.32

0.81

4.60

Env-PPAS

---------------------------------GPYLEQFEKVLSTYLHKRYVIATSSGTDAIMIGLLALGLNPGDEVIMPANSFSATENAVLASGGVPIYVDINPQTFCIDPDKIEEAITPYTKFILPVHLYGKHSDMQHIRQIANRYKLKVIEDACQGIGLTD----LGKYADITTLSFNPYNFGVCGKAGAIATDN

3dr4C

0.37

0.36

0.99

3.81

MUSTER

L--PRISVAAPRLDGNERDYVLECMDTTWISSVGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNAIITTGEGGMITTND

3dr4C

0.37

0.36

0.99

5.44

dPPAS

--LPRISVAAPRLDGNERDYVLECMDTTWISSVGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNAIITTGEGGMITTND

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=1.68

Estimated TM-score = 0.95±0.05

Estimated RMSD = 2.1±1.7Å

Download Model 2

C-score=-4.27

Download Model 3

C-score=-4.61

Download Model 4

C-score=-5.00

Download Model 5

C-score=-4.78

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	3dr4C	0.946	1.19	0.365	0.990
2	4lc3A	0.939	1.23	0.393	0.985
3	2ogaA	0.921	1.58	0.330	0.990
4	2fniA	0.920	1.43	0.282	0.980
5	3bcxA	0.919	1.60	0.303	0.995
6	3frkA	0.916	1.58	0.327	0.985
7	1b9iA	0.911	1.84	0.305	0.990
8	2c7tA	0.909	1.68	0.369	0.980
9	4qgrA	0.908	1.72	0.310	0.990
10	4xauA	0.908	1.77	0.320	0.990

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.89	217	1b9iA	PXG	Rep, Mult	58,59,60,63,84,85,87,130,156,158,159,180,182,185
2	0.07	16	3dr7A	GPD	Rep, Mult	28,29,30,31,33
3	0.04	8	3dr7B	GPD	Rep, Mult	11,85,182,183,184,185
4	0.04	9	4wxbA	CIT	Rep, Mult	58,59,60,180,182,185,191
5	0.00	1	1mdxA	AKG	Rep, Mult	182,191
6	0.00	1	3cq6C	PO4	Rep, Mult	47,48,160,161,169,179
7	0.00	1	2tplB	HPP	Rep, Mult	10,85
8	0.00	1	3ju7B	CA	Rep, Mult	19
9	0.00	1	3b8xA	NA	Rep, Mult	77,100,119,120,121,123,124

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	2okjB	0.817	2.72	0.129	0.975	4.1.1.15	NA
2	0.060	1i29A	0.781	2.97	0.114	0.970	4.4.1.16	89
3	0.060	1gd9A	0.797	2.85	0.187	0.945	2.6.1.-	156
4	0.060	1c7gA	0.776	2.98	0.156	0.960	4.1.99.2	NA
5	0.060	1p3wB	0.790	2.79	0.125	0.965	2.8.1.7	182
6	0.060	3hbxA	0.793	2.76	0.113	0.965	4.1.1.15	180,182
7	0.060	1b9hA	0.911	1.85	0.305	0.990	4.2.1.-	85,156,185
8	0.060	1t3iA	0.781	2.91	0.161	0.960	2.8.1.7	NA
9	0.060	2wk7A	0.793	2.83	0.138	0.945	2.3.-.-	185
10	0.060	3k40A	0.787	2.99	0.114	0.970	4.1.1.28	158,182
11	0.060	2vmzA	0.782	3.05	0.157	0.955	2.1.2.1	58,158,185
12	0.060	1v2eA	0.780	3.02	0.187	0.950	2.6.1.15	85,156
13	0.060	2c7tA	0.909	1.68	0.369	0.980	2.6.1.-	156
14	0.060	1u08A	0.787	3.09	0.179	0.965	2.6.1.-	57,60
15	0.060	2zjgA	0.783	3.09	0.156	0.955	2.6.1.7,2.6.1.64	156
16	0.060	2jisB	0.815	2.83	0.143	0.985	4.1.1.29	156,185
17	0.060	3a2bA	0.804	2.70	0.143	0.950	2.3.1.50	156,185
18	0.060	1mdxA	0.911	1.46	0.412	0.975	2.6.1.87	156,185
19	0.060	1p3wA	0.790	2.80	0.125	0.965	2.8.1.7,4.4.1.-	156,185

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.58	0.909	1.63	0.34	0.98	3nu7B	GO:0000271 GO:0003824 GO:0008483 GO:0009103 GO:0009243 GO:0016740 GO:0030170 GO:0071555
1	0.50	0.913	1.55	0.65	0.98	4zahA	GO:0003824 GO:0009246 GO:0016740 GO:0019180 GO:0030170
2	0.49	0.909	1.68	0.37	0.98	2c7tA	GO:0003824 GO:0008483 GO:0016740 GO:0017000
3	0.48	0.911	1.85	0.30	0.99	1b9hA	GO:0003824 GO:0016740 GO:0016829 GO:0017000
4	0.48	0.911	1.46	0.41	0.97	1mdxA	GO:0003824 GO:0006629 GO:0008483 GO:0009103 GO:0009245 GO:0016740 GO:0046493 GO:0046677 GO:0099621
5	0.46	0.888	1.74	0.38	0.96	5k8bA	GO:0000271 GO:0003824 GO:0008483 GO:0009103 GO:0016740
6	0.45	0.919	1.60	0.30	0.99	3bcxA	GO:0003824 GO:0008483 GO:0016740
7	0.45	0.939	1.23	0.39	0.98	4lc3A	GO:0003824
8	0.44	0.920	1.43	0.28	0.98	2fniA	GO:0003824 GO:0008483 GO:0016740
9	0.43	0.921	1.58	0.33	0.99	2ogaA	GO:0003824 GO:0008483 GO:0016740 GO:0017000 GO:0030170 GO:0033068
10	0.40	0.903	1.93	0.24	0.99	2gmsA	GO:0003824 GO:0008483 GO:0016740
11	0.39	0.889	1.95	0.31	0.98	3uwcA	GO:0003824 GO:0008483 GO:0016740
12	0.38	0.910	1.74	0.32	0.99	4xauB	GO:0003824 GO:0008483 GO:0016740
13	0.34	0.916	1.58	0.33	0.98	3frkA	GO:0003824
14	0.32	0.907	1.59	0.29	0.98	4ztcA	GO:0003824 GO:0006486 GO:0008483 GO:0016740 GO:0047302
15	0.25	0.946	1.19	0.36	0.99	3dr4C	GO:0003824 GO:0008483 GO:0009103 GO:0009243 GO:0016740
16	0.24	0.781	2.91	0.16	0.96	1t3iA	GO:0003824 GO:0006534 GO:0016740 GO:0030170 GO:0031071
17	0.23	0.908	1.72	0.31	0.99	4qgrA	GO:0003824 GO:0008483 GO:0016740
18	0.21	0.889	1.75	0.27	0.96	4zasA	GO:0003824
19	0.20	0.894	1.89	0.34	0.97	4k2mA	GO:0003824 GO:0008483 GO:0016740 GO:0017000 GO:0030170
20	0.20	0.883	2.06	0.35	0.99	2po3A	GO:0003824
21	0.19	0.824	2.59	0.22	0.98	3ju7A	GO:0003824
22	0.18	0.804	2.70	0.14	0.95	3a2bA	GO:0003824 GO:0004758 GO:0008152 GO:0009058 GO:0016740 GO:0016746 GO:0030170
23	0.17	0.795	2.67	0.18	0.95	2bwoB	GO:0003824 GO:0003870 GO:0006782 GO:0006783 GO:0008152 GO:0009058 GO:0016740 GO:0016746 GO:0030170 GO:0033014
24	0.17	0.739	3.09	0.14	0.93	1vjoA	GO:0003824 GO:0008483 GO:0016740
25	0.14	0.773	3.17	0.18	0.95	2r5cB	GO:0003824 GO:0008483 GO:0009058 GO:0016740 GO:0030170
26	0.11	0.805	2.74	0.16	0.95	1bs0A	GO:0003824 GO:0008152 GO:0008710 GO:0009058 GO:0009102 GO:0016740 GO:0030170
27	0.08	0.782	3.15	0.13	0.96	3eleA	GO:0003824 GO:0008483 GO:0009058 GO:0016740 GO:0030170
28	0.08	0.780	3.02	0.19	0.95	1v2eA	GO:0003824 GO:0008483 GO:0009058 GO:0016740 GO:0030170
29	0.07	0.776	2.76	0.11	0.92	4iw7A	GO:0003824 GO:0008483 GO:0008710 GO:0009058 GO:0016740 GO:0016746 GO:0030170
30	0.07	0.787	3.09	0.18	0.96	1u08A	GO:0003824 GO:0005737 GO:0008483 GO:0009058 GO:0010326 GO:0016740 GO:0030170
31	0.07	0.762	3.26	0.14	0.95	4r2nA	GO:0000105 GO:0003824 GO:0004400 GO:0008152 GO:0008483 GO:0009058 GO:0016740 GO:0030170
32	0.07	0.792	2.84	0.14	0.94	3hqtB	GO:0003824 GO:0008483 GO:0009058 GO:0016740 GO:0016746 GO:0030170
33	0.07	0.797	2.85	0.19	0.94	1gd9A	GO:0003824 GO:0008483 GO:0009058 GO:0016740 GO:0030170
34	0.07	0.808	2.71	0.14	0.95	5jayA	GO:0003824 GO:0008710 GO:0009058 GO:0009102 GO:0016740 GO:0030170
35	0.07	0.787	3.18	0.22	0.96	1j32A	GO:0003824 GO:0004069 GO:0008483 GO:0009058 GO:0016740 GO:0030170 GO:0080130
36	0.07	0.803	2.83	0.13	0.97	3mc6A	GO:0003824 GO:0006629 GO:0006665 GO:0008117 GO:0009267 GO:0016829 GO:0016831 GO:0019722 GO:0019752 GO:0030170 GO:0032541 GO:0097038
37	0.07	0.810	2.44	0.18	0.94	4bmkA	GO:0003824 GO:0008152 GO:0009058 GO:0016740 GO:0030170
38	0.07	0.805	2.66	0.16	0.95	2x8uA	GO:0003824 GO:0004758 GO:0008152 GO:0009058 GO:0016740 GO:0016746 GO:0030170
39	0.07	0.771	3.05	0.21	0.94	3fvsA	GO:0003824 GO:0005654 GO:0005737 GO:0005829 GO:0006559 GO:0006569 GO:0006575 GO:0008483 GO:0008652 GO:0009058 GO:0016212 GO:0016740 GO:0016829 GO:0030170 GO:0042803 GO:0047312 GO:0047316 GO:0047804 GO:0047945 GO:0070189 GO:0097053
40	0.07	0.786	2.65	0.14	0.94	4w8iA	GO:0003824 GO:0008117 GO:0016829 GO:0016831 GO:0019752 GO:0030170
41	0.07	0.821	2.73	0.11	0.98	2okkA	GO:0000139 GO:0003824 GO:0004351 GO:0005737 GO:0005794 GO:0005829 GO:0005886 GO:0006540 GO:0007268 GO:0007269 GO:0016020 GO:0016023 GO:0016595 GO:0016829 GO:0016831 GO:0019752 GO:0030054 GO:0030170 GO:0030424 GO:0030672 GO:0031225 GO:0031410 GO:0042136 GO:0042493 GO:0042734 GO:0045202 GO:0046982 GO:0048471 GO:0060077 GO:0061202
42	0.07	0.767	2.45	0.15	0.89	2wk8B	GO:0003824 GO:0008483 GO:0009058 GO:0016740 GO:0016746 GO:0030170
43	0.07	0.791	3.12	0.22	0.96	2o0rA	GO:0003824 GO:0005618 GO:0005737 GO:0008483 GO:0008652 GO:0009016 GO:0009058 GO:0009085 GO:0009089 GO:0016740 GO:0030170
44	0.07	0.778	3.21	0.15	0.96	3dydA	GO:0003824 GO:0004838 GO:0005739 GO:0005829 GO:0006103 GO:0006520 GO:0006536 GO:0006559 GO:0006572 GO:0006979 GO:0008483 GO:0009058 GO:0009072 GO:0009074 GO:0014070 GO:0016597 GO:0016740 GO:0030170 GO:0046689 GO:0051384 GO:0080130
45	0.07	0.783	2.94	0.21	0.94	1b5oA	GO:0003824 GO:0004069 GO:0005737 GO:0008483 GO:0009058 GO:0016740 GO:0030170 GO:0080130
46	0.07	0.781	3.35	0.15	0.97	1o4sB	GO:0003824 GO:0004069 GO:0005737 GO:0008483 GO:0009058 GO:0016740 GO:0030170 GO:0080130
47	0.07	0.762	3.28	0.15	0.95	2o1bA	GO:0003824 GO:0008483 GO:0009058 GO:0016740 GO:0030170
48	0.07	0.758	3.32	0.13	0.95	4my5A	GO:0003824 GO:0008483 GO:0009058 GO:0016740 GO:0030170
49	0.07	0.779	3.20	0.19	0.96	3b46B	GO:0001558 GO:0003824 GO:0004061 GO:0005737 GO:0005739 GO:0008483 GO:0009058 GO:0016212 GO:0016740 GO:0030170 GO:0034276 GO:0047536 GO:0097053
50	0.07	0.784	2.86	0.18	0.94	1xi9C	GO:0003824 GO:0008483 GO:0009058 GO:0016740 GO:0030170
51	0.07	0.787	2.71	0.16	0.93	4cvqA	GO:0003824 GO:0004021 GO:0005737 GO:0006523 GO:0006974 GO:0008483 GO:0009058 GO:0016740 GO:0019272 GO:0030170 GO:0030632 GO:0046677
52	0.07	0.738	3.17	0.17	0.91	3ecdB	GO:0003824 GO:0004372 GO:0005737 GO:0006544 GO:0006545 GO:0006563 GO:0006730 GO:0008652 GO:0016740 GO:0019264 GO:0030170 GO:0035999
53	0.07	0.780	3.25	0.15	0.97	3e2yA	GO:0003824 GO:0005739 GO:0006103 GO:0006520 GO:0008483 GO:0009058 GO:0016212 GO:0016740 GO:0016829 GO:0030170 GO:0042803 GO:0044822 GO:0047315 GO:0047804 GO:0070189 GO:0097052
54	0.07	0.738	2.95	0.13	0.89	3n0lB	GO:0003824 GO:0004372 GO:0005737 GO:0006544 GO:0006545 GO:0006563 GO:0006730 GO:0008652 GO:0016740 GO:0019264 GO:0030170 GO:0035999

Consensus prediction of GO terms

Molecular Function	GO:0030170	GO:0019180	GO:0016829	GO:0099621
GO-Score	0.79	0.50	0.48	0.47
Biological Processes	GO:0017000	GO:0071555	GO:0009243	GO:0009246	GO:0046677	GO:0009245
GO-Score	0.74	0.58	0.58	0.50	0.47	0.47
Cellular Component
GO-Score

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv1504c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]