I-TASSER results

I-TASSER results for job id Rv0901

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Input Sequence in FASTA format

>protein (175 residues)
MEHVHWWLAGLAFTLGMVLTSTLMVRPVEHQVLVKKSVRGSSAKSKPPTARKPAVKSGTK
REESPTAKTKVATESAAEQIPVAGEPAAEPIPVAGEPAARIPVVPYAPYGPGSARAGADG
SGPQGWLVKGRSDTRLYYTPEDPTYDPTVAQVWFQDEESAARAFFTPWRKSTRRT

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 \| \| \| \| \| \| \| \| MEHVHWWLAGLAFTLGMVLTSTLMVRPVEHQVLVKKSVRGSSAKSKPPTARKPAVKSGTKREESPTAKTKVATESAAEQIPVAGEPAAEPIPVAGEPAARIPVVPYAPYGPGSARAGADGSGPQGWLVKGRSDTRLYYTPEDPTYDPTVAQVWFQDEESAARAFFTPWRKSTRRT
Prediction	CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEHCCCCEEHCCCCCCCCCCCCCHCCCCHHHHHHHCCCCCCCCCCCC
Conf.Score	9745479999999999999987645776555545655666777777766666655556666777777666665555555666677655556677776666787788888887678888889999855766588876758999876556664336999999998998776666679
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 \| \| \| \| \| \| \| \| MEHVHWWLAGLAFTLGMVLTSTLMVRPVEHQVLVKKSVRGSSAKSKPPTARKPAVKSGTKREESPTAKTKVATESAAEQIPVAGEPAAEPIPVAGEPAARIPVVPYAPYGPGSARAGADGSGPQGWLVKGRSDTRLYYTPEDPTYDPTVAQVWFQDEESAARAFFTPWRKSTRRT
Prediction	6530200021213331321121121444555444664554564566545564545665555575655655444645465455565464564545654556455466444454444347556316523031245132010251531560414211422630462414445746678
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160

                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEHCCCCEEHCCCCCCCCCCCCCHCCCCHHHHHHHCCCCCCCCCCCC
MEHVHWWLAGLAFTLGMVLTSTLMVRPVEHQVLVKKSVRGSSAKSKPPTARKPAVKSGTKREESPTAKTKVATESAAEQIPVAGEPAAEPIPVAGEPAARIPVVPYAPYGPGSARAGADGSGPQGWLVKGRSDTRLYYTPEDPTYDPTVAQVWFQDEESAARAFFTPWRKSTRRT

1adnA

0.12

0.05

0.42

1.77

wdPPAS

----------------------------------------------------------------------------------------------------MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRA-RHALRESFYANASEALAAGFRPCKRCQPDK

1adnA

0.14

0.05

0.37

1.59

wPPAS

-------------------------------------------------------------------------------------------------------------MKKATCLTDDQPNADGEFVFAVRTTGIFCRPSCRA-RHALRESFYANASEALAAGFRPCKRCQPDK

4cwuT

0.14

0.06

0.41

1.67

dPPAS2

----------------------------------------------APGLGVQTVDVQETQTSPVASAVADAAVQAVAAAASKTSTEVQTDPWMFRVSAPRRPRGSRKYGAASALLPE---------------------------------------------------------

1mv3A

0.14

0.13

0.90

1.34

PPAS

VNH----------------EPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPVETFPATVNGTVEGGSGAGRLDLPPGFMYTATDTDIPFQNPEEQD-EGWLMGVKESDWN

1zgwA1

0.16

0.06

0.39

1.64

wdPPAS

-------------------------------------------------------------------------------------------------------MKKATCLTDDQR-LARDPNADGEFVFAVRTTGIFR-PSCRA-RHALRESFYANASEALAAGFRPCKRCQPDK

1zgwA1

0.14

0.05

0.37

1.56

wPPAS

-------------------------------------------------------------------------------------------------------------MKKATCLTDDQPNADGEFVFAVRTTGIFR-PSCRA-RHALRESFYANASEALAAGFRPCKRCQPDK

2mxxA

0.08

0.06

0.69

1.53

dPPAS2

EGGSHNYGEVKAAYEAAFNNAFNAVRNKYVQRFQATYNNATEQEGKTYIQGETPEQANARYLKRVGAANNQNPAAEDKGATTPASKEEAKKSEAAAKNAGKAAGKALPKTSAVKHHHHHH-------------------------------------------------------

2xgfA

0.10

0.09

0.93

1.14

PPAS

FDKSAYPKLAVAYMRGQTIKGKPSGRAVLSAEADGVKAHSHSASASSTDLGTKTTSSFDYGTKGTNSTGGHTHSGSGSTSTNGEHSHYIEAWNGTGVGGNKMSSYAISYRAGGSNTNAAGNHSHTFSFGTSSAGDHSHSVGIGAHTHTVA------------IGSHGHTITVNST

1mv3A

0.12

0.10

0.82

1.07

wPPAS

LRK---------------------PVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQA---QH------DYTATDTELQLKNPEEQD-EGWNQHKKLEKCR

5gaoE

0.14

0.13

0.94

1.45

dPPAS2

AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA-----AAAA---AAAAAAAAAAAAA---AAAAAAAAAAAAAAAAAAAAA

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-4.64

Estimated TM-score = 0.24±0.07

Estimated RMSD = 16.4±3.0Å

Download Model 2

C-score=-4.70

Download Model 3

C-score=-4.83

Download Model 4

C-score=-5.00

Download Model 5

C-score=-5.00

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	3kg2A	0.391	5.45	0.065	0.691
2	2i69A	0.362	4.88	0.053	0.583
3	1ha0A	0.337	5.17	0.050	0.560
4	1sjjA	0.321	5.65	0.030	0.589
5	2fkjA	0.318	5.08	0.101	0.549
6	3kdpA	0.314	5.25	0.048	0.537
7	1jzsA	0.310	5.73	0.042	0.571
8	2j8sA	0.303	5.32	0.040	0.526
9	2r02A	0.302	5.49	0.039	0.531
10	3ba6A	0.300	5.17	0.081	0.526

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.10	5	2al4C	CX6	Rep, Mult	56,57,144,145,146
2	0.08	4	1vf5C	III	Rep, Mult	15,19
3	0.04	2	3tdjA	3TJ	Rep, Mult	146,147,148,149,150
4	0.04	2	4fe1K	CLA	Rep, Mult	157,160
5	0.04	2	1qlqA	SO4	Rep, Mult	135,145,150
6	0.04	2	1ijdA	RPA	Rep, Mult	8,11,14,18
7	0.02	1	3zweA	FUC	Rep, Mult	145,153
8	0.02	1	2vd3B	MG	Rep, Mult	63,142
9	0.02	1	3mkvA	ZN	Rep, Mult	3,5,129
10	0.02	1	2omxB	CA	Rep, Mult	129,133
11	0.02	1	4ub8H	CLA	Rep, Mult	6,13
12	0.02	1	4ro2B	GLY	Rep, Mult	8,11
13	0.02	1	1y66A	DIO	Rep, Mult	4,8
14	0.02	1	2idkA	C2F	Rep, Mult	137,139
15	0.02	1	2h3cB	NUC	Rep, Mult	129,131,137

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	3b8eC	0.245	5.96	0.039	0.474	3.6.3.9	NA
2	0.060	1n63B	0.261	4.76	0.046	0.434	1.2.99.2	NA
3	0.060	1eulA	0.262	5.26	0.035	0.434	3.6.3.8	NA
4	0.060	2of6B	0.270	6.04	0.059	0.503	2.7.7.48,3.4.21.91	NA
5	0.060	2g25A	0.255	5.40	0.029	0.434	1.2.4.1	5
6	0.060	2c10B	0.248	5.29	0.043	0.446	1.4.3.21,1.4.3.6	NA
7	0.060	1fo4A	0.260	4.78	0.029	0.429	1.17.1.4	NA
8	0.060	3b9jJ	0.192	5.03	0.028	0.320	1.17.1.4,1.17.3.2	NA
9	0.060	3kvnX	0.256	4.43	0.023	0.394	3.1.1.1	NA
10	0.060	2w68C	0.146	5.27	0.010	0.257	3.2.1.18	156
11	0.060	1ileA	0.205	5.79	0.000	0.389	6.1.1.5	NA
12	0.060	1kitA	0.257	5.03	0.012	0.423	3.2.1.18	NA
13	0.060	3hi7A	0.269	4.71	0.045	0.434	1.4.3.22	NA
14	0.060	2qtcB	0.217	5.63	0.042	0.400	1.2.4.1	58
15	0.060	1av4A	0.252	4.54	0.049	0.394	1.4.3.21,1.4.3.6	NA
16	0.060	2ckjA	0.254	5.10	0.044	0.429	1.17.1.4,1.17.3.2	NA
17	0.060	1tt0A	0.248	4.30	0.029	0.371	1.1.3.10	NA
18	0.060	3hmjA	0.274	5.56	0.034	0.480	2.3.1.86	NA
19	0.060	1l8aA	0.254	5.25	0.029	0.429	1.2.4.1	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.06	0.232	6.71	0.03	0.51	4u1wA	GO:0001919 GO:0004872 GO:0004970 GO:0004971 GO:0005216 GO:0005234 GO:0005246 GO:0005783 GO:0005789 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0007268 GO:0008328 GO:0009986 GO:0010226 GO:0014069 GO:0015277 GO:0016020 GO:0016021 GO:0019901 GO:0030054 GO:0030165 GO:0030425 GO:0030426 GO:0030672 GO:0031623 GO:0032279 GO:0032281 GO:0032839 GO:0034220 GO:0035235 GO:0042734 GO:0042802 GO:0043025 GO:0043195 GO:0043197 GO:0043198 GO:0043204 GO:0043234 GO:0045184 GO:0045202 GO:0045211 GO:0050806 GO:0051262 GO:0051966 GO:0060992
1	0.06	0.270	6.33	0.04	0.56	4uqqA	GO:0001662 GO:0004872 GO:0004970 GO:0005216 GO:0005234 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0006874 GO:0006886 GO:0007268 GO:0008066 GO:0008328 GO:0014069 GO:0015277 GO:0016020 GO:0016021 GO:0019228 GO:0030054 GO:0030165 GO:0030424 GO:0030425 GO:0031624 GO:0031625 GO:0032839 GO:0032983 GO:0034220 GO:0035235 GO:0035249 GO:0042391 GO:0042734 GO:0042802 GO:0042803 GO:0043025 GO:0043113 GO:0043195 GO:0043204 GO:0043524 GO:0043525 GO:0045202 GO:0045211 GO:0046328 GO:0048169 GO:0048172 GO:0050804 GO:0050806 GO:0051402 GO:0051967 GO:0060079 GO:0060080
2	0.06	0.372	5.45	0.04	0.66	5iouA	GO:0004872 GO:0004970 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0035235 GO:0045202 GO:0045211
3	0.06	0.297	5.78	0.03	0.54	5idfB	GO:0001919 GO:0004872 GO:0004970 GO:0004971 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0008328 GO:0010226 GO:0014069 GO:0016020 GO:0016021 GO:0030054 GO:0030165 GO:0030425 GO:0032279 GO:0032281 GO:0034220 GO:0035235 GO:0043025 GO:0043083 GO:0043195 GO:0043197 GO:0043198 GO:0043204 GO:0043234 GO:0045202 GO:0045211 GO:0060992
4	0.06	0.284	5.88	0.04	0.54	4pe5C	GO:0004872 GO:0004970 GO:0004972 GO:0005102 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0007611 GO:0010942 GO:0014069 GO:0014070 GO:0014075 GO:0016020 GO:0016021 GO:0016594 GO:0016595 GO:0017146 GO:0019899 GO:0022843 GO:0030054 GO:0032590 GO:0034220 GO:0034765 GO:0035235 GO:0035254 GO:0042165 GO:0043025 GO:0043083 GO:0043195 GO:0043197 GO:0044307 GO:0045202 GO:0045211 GO:0046982 GO:0046983 GO:0048511 GO:0051262 GO:0051592 GO:0060076 GO:0060992 GO:0071287 GO:2000463
5	0.06	0.251	5.83	0.04	0.47	4uq6B	GO:0001919 GO:0004872 GO:0004970 GO:0004971 GO:0005216 GO:0005234 GO:0005246 GO:0005783 GO:0005789 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0007268 GO:0008328 GO:0009986 GO:0010226 GO:0014069 GO:0015277 GO:0016020 GO:0016021 GO:0019901 GO:0030054 GO:0030165 GO:0030425 GO:0030426 GO:0030672 GO:0031623 GO:0032279 GO:0032281 GO:0032839 GO:0034220 GO:0035235 GO:0042734 GO:0042802 GO:0043025 GO:0043195 GO:0043197 GO:0043198 GO:0043204 GO:0043234 GO:0045184 GO:0045202 GO:0045211 GO:0050806 GO:0051262 GO:0051966 GO:0060992
6	0.06	0.293	5.53	0.04	0.54	4u1xC	GO:0001919 GO:0004872 GO:0004970 GO:0004971 GO:0005216 GO:0005234 GO:0005246 GO:0005783 GO:0005789 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0007268 GO:0008328 GO:0009986 GO:0010226 GO:0014069 GO:0015277 GO:0016020 GO:0016021 GO:0019901 GO:0030054 GO:0030165 GO:0030425 GO:0030426 GO:0030672 GO:0031623 GO:0032279 GO:0032281 GO:0032839 GO:0034220 GO:0035235 GO:0042734 GO:0042802 GO:0043025 GO:0043195 GO:0043197 GO:0043198 GO:0043204 GO:0043234 GO:0045184 GO:0045202 GO:0045211 GO:0050806 GO:0051262 GO:0051966 GO:0060992
7	0.06	0.296	5.39	0.04	0.50	5fxiB	GO:0001508 GO:0001975 GO:0004872 GO:0004970 GO:0004972 GO:0005102 GO:0005149 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0007611 GO:0007613 GO:0007616 GO:0008013 GO:0008144 GO:0008270 GO:0008306 GO:0009612 GO:0009636 GO:0009743 GO:0010042 GO:0010350 GO:0010942 GO:0014049 GO:0014069 GO:0014070 GO:0014075 GO:0016020 GO:0016021 GO:0017146 GO:0021766 GO:0021987 GO:0030018 GO:0030054 GO:0031749 GO:0032026 GO:0033555 GO:0034097 GO:0034220 GO:0035235 GO:0035255 GO:0042165 GO:0042220 GO:0042734 GO:0043005 GO:0043083 GO:0043113 GO:0043195 GO:0043197 GO:0043408 GO:0045202 GO:0045211 GO:0045471 GO:0046872 GO:0046982 GO:0048169 GO:0048511 GO:0050806 GO:0050839 GO:0051592 GO:0051597 GO:0051602 GO:0051707 GO:0060416 GO:0060992 GO:0071230 GO:0071287 GO:0071359 GO:0071363 GO:0071396 GO:0071407
8	0.06	0.367	5.36	0.05	0.63	5fxkA	GO:0004872 GO:0004970 GO:0004972 GO:0005102 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0007611 GO:0010942 GO:0014069 GO:0014070 GO:0014075 GO:0016020 GO:0016021 GO:0016594 GO:0016595 GO:0017146 GO:0019899 GO:0022843 GO:0030054 GO:0032590 GO:0034220 GO:0034765 GO:0035235 GO:0035254 GO:0042165 GO:0043025 GO:0043083 GO:0043195 GO:0043197 GO:0044307 GO:0045202 GO:0045211 GO:0046982 GO:0046983 GO:0048511 GO:0051262 GO:0051592 GO:0060076 GO:0060992 GO:0071287 GO:2000463
9	0.06	0.199	4.63	0.04	0.31	5ipqB	GO:0004872 GO:0004970 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0035235 GO:0045202 GO:0045211
10	0.06	0.391	5.45	0.07	0.69	3kg2A	GO:0001919 GO:0004872 GO:0004970 GO:0004971 GO:0005216 GO:0005234 GO:0005246 GO:0005783 GO:0005789 GO:0005886 GO:0005887 GO:0006810 GO:0006811 GO:0007268 GO:0008328 GO:0009986 GO:0010226 GO:0014069 GO:0015277 GO:0016020 GO:0016021 GO:0019901 GO:0030054 GO:0030165 GO:0030425 GO:0030426 GO:0030672 GO:0031623 GO:0032279 GO:0032281 GO:0032839 GO:0034220 GO:0035235 GO:0042734 GO:0042802 GO:0043025 GO:0043195 GO:0043197 GO:0043198 GO:0043204 GO:0043234 GO:0045184 GO:0045202 GO:0045211 GO:0050806 GO:0051262 GO:0051966 GO:0060992
11	0.06	0.264	5.38	0.02	0.48	4tllD	GO:0004872 GO:0004970 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0035235 GO:0045202 GO:0045211
12	0.06	0.277	5.71	0.02	0.51	4tlmC	GO:0004872 GO:0004970 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0035235 GO:0045202 GO:0045211
13	0.06	0.252	5.57	0.03	0.46	5iovB	GO:0004872 GO:0004970 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0035235 GO:0045202 GO:0045211
14	0.06	0.344	5.34	0.06	0.60	4tllA	GO:0004872 GO:0004970 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0016020 GO:0016021 GO:0030054 GO:0034220 GO:0035235 GO:0045202 GO:0045211
15	0.06	0.253	4.18	0.07	0.38	3sajC	GO:0001919 GO:0001965 GO:0004872 GO:0004970 GO:0004971 GO:0005216 GO:0005234 GO:0005769 GO:0005783 GO:0005789 GO:0005829 GO:0005886 GO:0006810 GO:0006811 GO:0007616 GO:0008179 GO:0008328 GO:0009636 GO:0009986 GO:0010226 GO:0014069 GO:0014070 GO:0016020 GO:0016021 GO:0019228 GO:0019901 GO:0019904 GO:0021510 GO:0030054 GO:0030165 GO:0030425 GO:0031267 GO:0031489 GO:0031594 GO:0031623 GO:0031681 GO:0031698 GO:0032279 GO:0032281 GO:0032355 GO:0034220 GO:0035235 GO:0035249 GO:0042220 GO:0042493 GO:0042802 GO:0042803 GO:0042995 GO:0043005 GO:0043025 GO:0043197 GO:0043198 GO:0043234 GO:0043434 GO:0044309 GO:0045202 GO:0045211 GO:0045838 GO:0046685 GO:0048167 GO:0050804 GO:0050806 GO:0051018 GO:0051602 GO:0060076 GO:0060992 GO:0071230 GO:0071359 GO:0071363 GO:0071375 GO:0071407 GO:0071418
16	0.06	0.192	5.24	0.06	0.33	5hmtA	GO:0005215 GO:0006810
17	0.06	0.224	3.98	0.03	0.31	4mqeA	GO:0001649 GO:0004871 GO:0004930 GO:0004965 GO:0005576 GO:0005615 GO:0005737 GO:0005789 GO:0005886 GO:0005887 GO:0007165 GO:0007186 GO:0007193 GO:0007194 GO:0007214 GO:0008021 GO:0008134 GO:0008285 GO:0014048 GO:0014049 GO:0014053 GO:0016020 GO:0016021 GO:0030054 GO:0030425 GO:0030673 GO:0030817 GO:0031966 GO:0032811 GO:0033602 GO:0035094 GO:0038037 GO:0038039 GO:0042734 GO:0042995 GO:0043005 GO:0043025 GO:0043197 GO:0043198 GO:0043231 GO:0045121 GO:0045202 GO:0045211 GO:0045471 GO:0050805 GO:0060124
18	0.06	0.262	5.11	0.05	0.46	4pe5D	GO:0001508 GO:0001975 GO:0004872 GO:0004970 GO:0004972 GO:0005102 GO:0005149 GO:0005216 GO:0005234 GO:0005886 GO:0006810 GO:0006811 GO:0007611 GO:0007613 GO:0007616 GO:0008013 GO:0008144 GO:0008270 GO:0008306 GO:0009612 GO:0009636 GO:0009743 GO:0010042 GO:0010350 GO:0010942 GO:0014049 GO:0014069 GO:0014070 GO:0014075 GO:0016020 GO:0016021 GO:0017146 GO:0021766 GO:0021987 GO:0030018 GO:0030054 GO:0031749 GO:0032026 GO:0033555 GO:0034097 GO:0034220 GO:0035235 GO:0035255 GO:0042165 GO:0042220 GO:0042734 GO:0043005 GO:0043083 GO:0043113 GO:0043195 GO:0043197 GO:0043408 GO:0045202 GO:0045211 GO:0045471 GO:0046872 GO:0046982 GO:0048169 GO:0048511 GO:0050806 GO:0050839 GO:0051592 GO:0051597 GO:0051602 GO:0051707 GO:0060416 GO:0060992 GO:0071230 GO:0071287 GO:0071359 GO:0071363 GO:0071396 GO:0071407

Consensus prediction of GO terms

Molecular Function	GO:0022824	GO:0005231	GO:0008066	GO:0019904
GO-Score	0.56	0.56	0.56	0.36
Biological Processes	GO:0055085	GO:0007215	GO:0009636
GO-Score	0.56	0.56	0.36
Cellular Component	GO:0097060	GO:0060076	GO:0098793	GO:0044297	GO:0036477	GO:0099572	GO:0043679	GO:0098802	GO:0098878	GO:0034702	GO:0005887	GO:0044309
GO-Score	0.56	0.46	0.46	0.46	0.46	0.46	0.46	0.36	0.36	0.36	0.36	0.36

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.