I-TASSER results

Input Sequence in FASTA format

>protein (213 residues)
MQTGQNRGRWSGVPLESRHALRRDNLVAAGVQLLGGAGGPALTVRAVCRHAGLTERYFYE
SFADREHFVRAVYDDVCTRAMATLTSAQTPREAVEQFVELMVDDPVRGRVLLLAPAVEPA
LTRSGAEWMPNFIELLQRKLSRIVDPVLQKLVATSLIGALTGLFTAYLNGRLGATRKQFI
DYCVNMLLSTAATYAPHRERGESEHSIPAGPHN

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 180 200 \| \| \| \| \| \| \| \| \| \| MQTGQNRGRWSGVPLESRHALRRDNLVAAGVQLLGGAGGPALTVRAVCRHAGLTERYFYESFADREHFVRAVYDDVCTRAMATLTSAQTPREAVEQFVELMVDDPVRGRVLLLAPAVEPALTRSGAEWMPNFIELLQRKLSRIVDPVLQKLVATSLIGALTGLFTAYLNGRLGATRKQFIDYCVNMLLSTAATYAPHRERGESEHSIPAGPHN
Prediction	CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEEEEHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC
Conf.Score	998899888889999999999999999999999998698768999999998999777666679999999999999999999986656558999999999999787637899884777889999999999999999999985688875579999999999999999999768999999999999999999976667888888887888888899
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 180 200 \| \| \| \| \| \| \| \| \| \| MQTGQNRGRWSGVPLESRHALRRDNLVAAGVQLLGGAGGPALTVRAVCRHAGLTERYFYESFADREHFVRAVYDDVCTRAMATLTSAQTPREAVEQFVELMVDDPVRGRVLLLAPAVEPALTRSGAEWMPNFIELLQRKLSRIVDPVLQKLVATSLIGALTGLFTAYLNGRLGATRKQFIDYCVNMLLSTAATYAPHRERGESEHSIPAGPHN
Prediction	675666544446344752355114301400240035421441214300531713431003206413200110043015303520551640240020002102513310100011242344024213411420140024216643564222000100120012002111456472424300300140013113334444665655554466568
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200

                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEEEEHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC
MQTGQNRGRWSGVPLESRHALRRDNLVAAGVQLLGGAGGPALTVRAVCRHAGLTERYFYESFADREHFVRAVYDDVCTRAMATLTSAQTPREAVEQFVELMVDDPVRGRVLLLAPAVEPALTRSGAEWMPNFIELLQRKLSRIVDPVLQKLVATSLIGALTGLFTAYLNGRLGATRKQFIDYCVNMLLSTAATYAPHRERGESEHSIPAGPHN

2qibA

0.14

0.13

0.92

1.72

MUSTER

-----------------GVEERRQQLIGVALDLFSRRSPDEVSIDEIASAAGISRPLVYHYFPGKLSLYEAALQRASDDLADRFVEPGARLLRVGRYFDFVDEHGPGFSALRGGPAGSTTTNALVDSVRQAAYVQILSHLDVTEPPARLELVVRSWISLAESTALLWLDGR-RIPRAELETQLVHDFAALAVSAAYDEEGALVRRVLADEPED

2w53A

0.13

0.12

0.90

1.65

dPPAS

----------------EDTQATREGILDAAEACFHEHGVARTTLEMIGARAGYTRGAVYWHFKNKSEVLAAIVERVHLPFMQELERTHDLRAVMIHSFIELSEDERLRKTMEIMLRSTEMQQAGFRDALDRMERALRRARDLGQEGADPKIAARMLHATVLGVLHGAMVEPELMDLKRDGMLALDMTLAAYVKDGVFVPGTVPEPLP------

2qibA

0.15

0.14

0.92

2.00

wdPPAS

-----------------GVEERRQQLIGVALDLFSRRSPDEVSIDEIASAAGISRPLVYHYFPGKLSLYEAALQRASDDLADRFVEPGARLLRVGRYFDFVDEHGPGFSALRGGPAVSTTTNALVDSVRQAAYVQILSHLDVTEPPARLELVVRSWISLAESTALLWLDGR-RIPRAELETQLVHDFAALAVSAAYDEEGALVRRVLADEPED

2qibA

0.14

0.13

0.92

2.07

wMUSTER

-----------------GVEERRQQLIGVALDLFSRRSPDEVSIDEIASAAGISRPLVYHYFPGKLSLYEAALQRASDDLADRFVEPGARLLRVGRYFDFVDEHGPGFSALRGGPAGSTTTNALVDSVRQAAYVQILSHLDVTEPPARLELVVRSWISLAESTALLWLDGR-RIPRAELETQLVHDFAALAVSAAYDEEGALVRRVLADEPED

2raeA

0.15

0.13

0.85

2.39

wPPAS

IG--------------RRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQDGLTAALLQFNAFPASEEINHRKRMGVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLD-DDSLELNELLASGMQSLYDGLSSLGEP----------------

2qibA

0.15

0.14

0.92

2.20

dPPAS2

-----------------GVEERRQQLIGVALDLFSRRSPDEVSIDEIASAAGISRPLVYHYFPGKLSLYEAALQRASDDLADRFVEPGARLLRVGRYFDFVDEHGPGFSALRGGPAVSTTTNALVDSVRQAAYVQILSHLDVTEPPARLELVVRSWISLAESTALLWLDGRR-IPRAELETQLVHDFAALAVSAAYDEEGALVRRVLADEPED

2qibA

0.15

0.14

0.92

2.13

PPAS

-----------------GVEERRQQLIGVALDLFSRRSPDEVSIDEIASAAGISRPLVYHYFPGKLSLYEAALQRASDDLADRFVEPGARLLRVGRYFDFVDEHGPGFSALRGGPAVSTTTNALVDSVRQAAYVQILSHLDVTEPPARLELVVRSWISLAESTALLWLDGR-RIPRAELETQLVHDFAALAVSAAYDEEGALVRRVLADEPED

4gctA

0.15

0.12

0.81

2.71

Env-PPAS

-------------------INRREEILQALAEMLENEGASRITTAKLAKQVGVSEAALYRHFPSKTRMFEGLIEFIEESLMSRINRINRIRLVMQLLLAFAERNPGLTRILSGHALMNERLRDRINQLFERIETSLRQILRERSFPVDENILAAQLLGQVEGSLNRFVRSDFKYLPTANFDEYWALLSAQIK---------------------

2raeA

0.14

0.12

0.85

1.71

MUSTER

IGRRPST--------------TQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASSPTDHVPRTVGYLLLGVAMSAYEQWLDDD-SLELNELLASGMQSLYDGLSSLGEP----------------

2qibA

0.15

0.14

0.92

1.62

dPPAS

-----------------GVEERRQQLIGVALDLFSRRSPDEVSIDEIASAAGISRPLVYHYFPGKLSLYEAALQRASDDLADRFVEPGARLLRVGRYFDFVDEHGPGFSALRGGPAVSTTTNALVDSVRQAAYVQILSHLDVTEPPARLELVVRSWISLAESTALLWLDGRR-IPRAELETQLVHDFAALAVSAAYDEEGALVRRVLADEPED

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-0.30

Estimated TM-score = 0.67±0.12

Estimated RMSD = 6.1±3.8Å

Download Model 2

C-score=-2.29

Download Model 3

C-score=-3.11

Download Model 4

C-score=-3.52

Download Model 5

C-score=-3.40

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	2qibA	0.821	2.04	0.130	0.906
2	2np5A	0.708	2.38	0.156	0.812
3	4ichA	0.701	2.54	0.103	0.812
4	3g7rB	0.700	3.30	0.130	0.869
5	5d1rA	0.693	2.90	0.143	0.836
6	3crjA	0.688	2.50	0.129	0.798
7	3qbmA	0.687	2.70	0.138	0.817
8	3eupA	0.686	2.96	0.137	0.831
9	3lsjA	0.683	3.18	0.145	0.864
10	3e7qB	0.681	3.26	0.194	0.855

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.23	21	3g1mA	RF3	Rep, Mult	84,89,90,93,94,97,129,135,136,139,157,160,161,164,187
2	0.07	6	1jtxA	CVI	Rep, Mult	80,100,101,104,125,128,129,157,158,161,165
3	0.06	4	1jt0C	QNA	Rep, Mult	42,43,44,55,59,64,65
4	0.05	5	3br1A	DEQ	Rep, Mult	73,76,77,80,100,101,104,121,128
5	0.02	2	3lsrA	NUC	Rep, Mult	14,15,43,44,45,49,55,56,59
6	0.02	2	2gbyA	BRN	Rep, Mult	112,129,133,158
7	0.02	2	2nx40	III	Rep, Mult	35,36,37,38,109,111,113,114,115,126,133,150,151,154,155,158,159,162,163,165,166,168,169,170,174,178,181,182,185,186
8	0.02	2	3lsrA	QNA	Rep, Mult	43,44,45,49,55,56,59
9	0.01	1	3lsjB	COA	Rep, Mult	94,139,184,187,188
10	0.01	1	2eh3A	MG	Rep, Mult	96,99

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	1w36B	0.441	5.56	0.056	0.751	3.1.11.5	156
2	0.060	3igyB	0.436	5.59	0.044	0.737	5.4.2.1	NA
3	0.060	1f0iA	0.450	5.52	0.041	0.732	3.1.4.4	NA
4	0.060	3gtgB	0.451	5.66	0.053	0.779	2.7.7.6	161
5	0.060	1rblA	0.424	4.77	0.078	0.634	4.1.1.39	NA
6	0.060	1mswD	0.380	5.03	0.068	0.596	2.7.7.6	NA
7	0.060	1iv8A	0.452	5.15	0.061	0.742	5.4.99.15	NA
8	0.060	1uyrA	0.451	5.41	0.054	0.742	6.4.1.2,6.3.4.14	157
9	0.060	1o98A	0.431	6.01	0.042	0.775	5.4.2.1	NA
10	0.060	3bfjA	0.429	5.40	0.072	0.723	1.1.1.202	NA
11	0.060	2d0tB	0.433	5.94	0.078	0.775	1.13.11.52	NA
12	0.060	2o1xC	0.457	5.21	0.062	0.747	2.2.1.7	NA
13	0.060	1svdA	0.397	5.00	0.054	0.624	4.1.1.39	NA
14	0.060	2ifyA	0.318	5.31	0.041	0.526	5.4.2.1	NA
15	0.060	1xjjA	0.440	5.32	0.070	0.714	1.17.4.1	NA
16	0.060	2pywA	0.431	4.06	0.110	0.610	2.7.1.100	64
17	0.060	2o1xB	0.462	5.41	0.054	0.775	2.2.1.7	NA
18	0.060	2ztgA	0.460	5.89	0.076	0.807	6.1.1.7	37
19	0.060	2i2xA	0.458	5.18	0.048	0.732	2.1.1.90	77

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.35	0.617	3.17	0.10	0.77	3egqA	GO:0003677 GO:0006351 GO:0006355
1	0.32	0.642	3.03	0.18	0.79	3f1bA	GO:0003677 GO:0006351 GO:0006355
2	0.32	0.660	3.45	0.13	0.86	3bcgA	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0008144 GO:0042493 GO:0043565 GO:0045892
3	0.31	0.649	2.94	0.15	0.80	3bruA	GO:0003677 GO:0006351 GO:0006355
4	0.30	0.640	3.58	0.14	0.84	2hytA	GO:0003677 GO:0006351 GO:0006355
5	0.30	0.673	2.74	0.17	0.79	4l62A	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355
6	0.30	0.606	3.55	0.10	0.80	3ppbA	GO:0003677 GO:0006351 GO:0006355
7	0.29	0.535	3.04	0.09	0.66	3ljlA	GO:0003677
8	0.29	0.558	3.16	0.14	0.70	2qwtA	GO:0003677 GO:0006351 GO:0006355
9	0.29	0.639	3.28	0.16	0.82	2id6A	GO:0003677 GO:0006351 GO:0006355
10	0.28	0.612	3.59	0.12	0.83	2wuiA	GO:0003677 GO:0006351 GO:0006355
11	0.28	0.589	3.69	0.15	0.80	4g12A	GO:0003677 GO:0006351 GO:0006355
12	0.28	0.672	2.70	0.17	0.80	2g3bA	GO:0003677 GO:0006351 GO:0006355
13	0.28	0.831	2.13	0.12	0.92	2qibA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
14	0.27	0.665	3.43	0.13	0.86	3lhqA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
15	0.27	0.588	4.03	0.14	0.81	3vprA	GO:0003677 GO:0006351 GO:0006355 GO:0042802
16	0.27	0.607	3.60	0.15	0.80	3he0C	GO:0003677 GO:0006351 GO:0006355
17	0.27	0.681	3.26	0.19	0.85	3e7qB	GO:0003677 GO:0003700 GO:0006351 GO:0006355
18	0.26	0.604	3.68	0.10	0.82	3hggA	GO:0003677 GO:0006351 GO:0006355
19	0.26	0.663	3.35	0.15	0.85	3vibC	GO:0003677 GO:0006351 GO:0006355
20	0.26	0.573	4.02	0.12	0.81	3s5rA	GO:0003677 GO:0006351 GO:0006355
21	0.26	0.673	2.91	0.16	0.81	4yzeA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0045892
22	0.26	0.710	2.49	0.10	0.82	4ichA	GO:0003677 GO:0006351 GO:0006355
23	0.25	0.601	4.00	0.15	0.85	4pxiB	GO:0003677 GO:0006351 GO:0006355
24	0.25	0.644	3.24	0.09	0.81	3f0cA	GO:0003677 GO:0006351 GO:0006355
25	0.25	0.631	3.03	0.10	0.78	2zcnD	GO:0003677 GO:0006351 GO:0006355
26	0.24	0.553	3.84	0.12	0.75	3vuqC	GO:0003677 GO:0006351 GO:0006355
27	0.24	0.622	3.33	0.06	0.80	4mk6A	GO:0003677 GO:0006351 GO:0006355
28	0.24	0.621	3.37	0.10	0.81	3mnlA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0042803
29	0.24	0.677	3.05	0.17	0.83	5f1jA	GO:0003677 GO:0006351 GO:0006355
30	0.24	0.649	3.46	0.15	0.86	1rktA	GO:0003677 GO:0006351 GO:0006355
31	0.24	0.618	3.37	0.07	0.80	3bjbB	GO:0003677 GO:0006351 GO:0006355
32	0.23	0.628	3.08	0.14	0.79	4aciB	GO:0000287 GO:0003677 GO:0006351 GO:0006355 GO:0046872
33	0.23	0.631	3.91	0.10	0.85	3angC	GO:0003677 GO:0006351 GO:0006355
34	0.23	0.562	3.85	0.12	0.77	3dewA	GO:0003677 GO:0006351 GO:0006355 GO:0016020 GO:0016021
35	0.23	0.660	3.15	0.17	0.83	2oi8A	GO:0003677 GO:0006351 GO:0006355
36	0.23	0.644	3.29	0.14	0.84	3mvpA	GO:0003677 GO:0006351 GO:0006355
37	0.22	0.615	3.41	0.14	0.80	4gctC	GO:0000976 GO:0003677 GO:0003700 GO:0005737 GO:0005829 GO:0006355 GO:0007049 GO:0009295 GO:0010974 GO:0043565 GO:0043590 GO:0051301 GO:0051302
38	0.22	0.575	4.14	0.13	0.81	3cwrA	GO:0003677 GO:0006351 GO:0006355
39	0.22	0.568	3.82	0.12	0.78	5d1wD	GO:0003677 GO:0006351 GO:0006355
40	0.22	0.634	3.12	0.08	0.79	3geuA	GO:0003677 GO:0006351 GO:0006355
41	0.22	0.647	3.65	0.14	0.86	2uxhA	GO:0003677 GO:0006351 GO:0006355
42	0.22	0.648	3.39	0.11	0.83	4gclB	GO:0003677 GO:0005737 GO:0007049 GO:0009295 GO:0010974 GO:0043565 GO:0043590 GO:0051301 GO:0051302
43	0.21	0.617	3.66	0.14	0.83	3pasB	GO:0003677 GO:0006351 GO:0006355
44	0.21	0.674	3.01	0.11	0.82	3whcA	GO:0003677 GO:0005737 GO:0006351 GO:0006355 GO:0006629 GO:0006631 GO:0016042
45	0.21	0.572	3.54	0.17	0.75	2q24B	GO:0003677 GO:0006351 GO:0006355
46	0.21	0.722	2.36	0.15	0.83	2np5A	GO:0003677 GO:0006351 GO:0006355
47	0.21	0.547	4.03	0.10	0.77	2np3B	GO:0003677 GO:0006351 GO:0006355
48	0.20	0.586	4.23	0.09	0.84	2rasB	GO:0003677 GO:0006351 GO:0006355
49	0.20	0.589	3.74	0.13	0.78	2pz9A	GO:0003677 GO:0003700 GO:0006351 GO:0006355
50	0.20	0.623	3.77	0.15	0.82	4nn1A	GO:0003677 GO:0003700 GO:0006351 GO:0006355
51	0.19	0.594	3.23	0.13	0.76	3bqyA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677
52	0.19	0.609	3.47	0.09	0.77	3vp5A	GO:0003677 GO:0006351 GO:0006355 GO:0046872
53	0.19	0.620	3.46	0.12	0.81	3kz9B	GO:0003677 GO:0006351 GO:0006355
54	0.18	0.677	2.96	0.15	0.81	2nx4A	GO:0003677 GO:0006351 GO:0006355
55	0.18	0.581	3.52	0.14	0.76	3ccyA	GO:0003677 GO:0006351 GO:0006355
56	0.18	0.582	3.44	0.13	0.77	2zozB	GO:0003677 GO:0006351 GO:0006355
57	0.18	0.627	3.59	0.13	0.82	3npiA	GO:0003677 GO:0006351 GO:0006355
58	0.18	0.529	4.04	0.14	0.75	3colA	GO:0003677 GO:0006351 GO:0006355
59	0.18	0.637	2.70	0.17	0.77	2dg8B	GO:0003677 GO:0006351 GO:0006355
60	0.18	0.647	3.37	0.12	0.84	3lwjA	GO:0003677 GO:0006351 GO:0006355
61	0.17	0.592	4.30	0.12	0.84	4jykA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0045892 GO:0045893
62	0.17	0.603	3.51	0.12	0.78	2o7tA	GO:0003677 GO:0006351 GO:0006355
63	0.16	0.542	4.32	0.08	0.77	3b81A	GO:0003677 GO:0006351 GO:0006355
64	0.16	0.609	2.97	0.13	0.77	2eh3A	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0046872
65	0.16	0.515	4.23	0.14	0.75	2ibdA	GO:0003677 GO:0006351 GO:0006355
66	0.15	0.618	3.39	0.14	0.81	2pbxA
67	0.15	0.558	4.34	0.12	0.80	3gziA	GO:0003677 GO:0006351 GO:0006355
68	0.15	0.592	4.10	0.12	0.79	4mxmA	GO:0003677 GO:0006351 GO:0006355
69	0.15	0.712	3.26	0.13	0.88	3g7rB	GO:0003677 GO:0003700 GO:0006351 GO:0006355
70	0.14	0.643	3.44	0.11	0.85	3c07A	GO:0003677 GO:0006351 GO:0006355
71	0.14	0.570	3.83	0.11	0.78	2fq4A	GO:0003677 GO:0006351 GO:0006355
72	0.14	0.627	3.03	0.12	0.77	3knwA	GO:0003677 GO:0006351 GO:0006355
73	0.14	0.513	4.11	0.09	0.70	2iaiA	GO:0003677 GO:0006351 GO:0006355
74	0.14	0.571	4.46	0.14	0.85	3nrgA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
75	0.14	0.629	2.95	0.18	0.77	2qkoB	GO:0003677 GO:0006351 GO:0006355
76	0.13	0.561	3.84	0.12	0.78	3cdlB	GO:0003677 GO:0006351 GO:0006355
77	0.13	0.552	4.16	0.07	0.76	4me9A	GO:0003677 GO:0006351 GO:0006355
78	0.13	0.582	4.17	0.13	0.83	3aqtB	GO:0003677 GO:0006351 GO:0006355
79	0.11	0.690	2.88	0.14	0.84	3dpjA	GO:0003677 GO:0006351 GO:0006355
80	0.08	0.600	3.68	0.15	0.79	3dcfA	GO:0003677 GO:0006351 GO:0006355
81	0.08	0.626	3.75	0.12	0.86	1t33A	GO:0003677 GO:0003700 GO:0006351 GO:0006355
82	0.07	0.588	3.91	0.15	0.81	2zb9A	GO:0003677 GO:0006351 GO:0006355
83	0.07	0.550	4.06	0.13	0.74	2rekB	GO:0003677 GO:0006351 GO:0006355
84	0.07	0.575	3.91	0.13	0.78	2raeA	GO:0003677 GO:0006351 GO:0006355
85	0.07	0.552	3.71	0.13	0.76	2guhA	GO:0003677 GO:0006351 GO:0006355
86	0.07	0.524	4.27	0.11	0.76	2dg7A	GO:0003677 GO:0006351 GO:0006355
87	0.07	0.498	4.46	0.10	0.71	2i10B	GO:0003677 GO:0006351 GO:0006355
88	0.07	0.549	4.31	0.12	0.79	2fbqA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0044212 GO:0045893 GO:0050714
89	0.07	0.520	4.27	0.12	0.75	2jj7B	GO:0003677 GO:0006351 GO:0006355 GO:0042802

Consensus prediction of GO terms

Molecular Function	GO:0043565	GO:0008144	GO:0003700
GO-Score	0.32	0.32	0.32
Biological Processes	GO:0045892	GO:0042493
GO-Score	0.32	0.32
Cellular Component
GO-Score

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv0825c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]