I-TASSER results

Input Sequence in FASTA format

>protein (213 residues)
MSSDVLVTTPAQRQTEPHAEAVSRNRRQQATFRKVLAAAMATLREKSYADLTVRLVAARA
KVAPATAYTYFSSKNHLIAEVYLDLVRQVPCVTDVNVPMPIRVTSSLRHLALVVADEPEI
GAACTAALLDGGADPAVRAVRDRIGAEIHRRITSAIGPGADPGTVFALEMAFFGALVQAG
SGTFTYHEIADRLGYVVGLILAGANEPSTGGSE

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 180 200 \| \| \| \| \| \| \| \| \| \| MSSDVLVTTPAQRQTEPHAEAVSRNRRQQATFRKVLAAAMATLREKSYADLTVRLVAARAKVAPATAYTYFSSKNHLIAEVYLDLVRQVPCVTDVNVPMPIRVTSSLRHLALVVADEPEIGAACTAALLDGGADPAVRAVRDRIGAEIHRRITSAIGPGADPGTVFALEMAFFGALVQAGSGTFTYHEIADRLGYVVGLILAGANEPSTGGSE
Prediction	CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Conf.Score	998888888888888888899986466899999999999999999797769999999998999999998789999999999999999866655678986557999999999999968557999999998678899999999999999999999997578886589999999999999998679999999999999999999846788988889
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 180 200 \| \| \| \| \| \| \| \| \| \| MSSDVLVTTPAQRQTEPHAEAVSRNRRQQATFRKVLAAAMATLREKSYADLTVRLVAARAKVAPATAYTYFSSKNHLIAEVYLDLVRQVPCVTDVNVPMPIRVTSSLRHLALVVADEPEIGAACTAALLDGGADPAVRAVRDRIGAEIHRRITSAIGPGADPGTVFALEMAFFGALVQAGSGTFTYHEIADRLGYVVGLILAGANEPSTGGSE
Prediction	866645464465555655666555744465215201400240036421551214300541713421003214313200120043015404422556452342013002100210142341120012003434424403401540343024102510464345421200210001001011223231530141023003101412553454468
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200

                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCC
MSSDVLVTTPAQRQTEPHAEAVSRNRRQQATFRKVLAAAMATLREKSYADLTVRLVAARAKVAPATAYTYFSSKNHLIAEVYLDLVRQVPCVTDVNVPMPIRVTSSLRHLALVVADEPEIGAACTAALLDGGADPAVRAVRDRIGAEIHRRITSAIGPGADPGTVFALEMAFFGALVQAGSGTFTYHEIADRLGYVVGLILAGANEPSTGGSE

3mnlA

0.21

0.18

0.85

1.83

MUSTER

----------------------LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFA--DASAASEVDQVEKLIDSMFARAMAGEPTEHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQD--------

3mnlA

0.21

0.18

0.85

1.60

dPPAS

----------------------LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFA--DASAASEVDQVEKLIDSMFARAMAGEPTEHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQD--------

3mnlA

0.21

0.18

0.85

2.00

wdPPAS

----------------------LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFA--DASAASEVDQVEKLIDSMFARAMAGEPTEHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQD--------

3mnlA

0.21

0.18

0.85

2.17

wMUSTER

-----------------------GSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFA--DASAASEVDQVEKLIDSMFARAMAGEPTEHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQD--------

3mnlA

0.21

0.18

0.85

2.47

wPPAS

----------------------LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFA--DASAASEVDQVEKLIDSMFARAMAGEPTEHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQ--------D

3mnlA

0.21

0.18

0.85

2.24

dPPAS2

----------------------LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFA--DASAASEVDQVEKLIDSMFARAMAGEPTEHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQD--------

3mnlA

0.21

0.18

0.85

2.26

PPAS

----------------------LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFA--DASAASEVDQVEKLIDSMFARAMAGEPTEHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQD--------

4jkzA

0.18

0.15

0.83

2.48

Env-PPAS

---------------------------SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALT-TRRGHAMLKTLMAASLEHDTAARLREGFSRPLIESVRDRLRDEDIDDHAQAAADALLGAVVNAVLSEGRSYS-RQRAETSARIIVAGLRP-------

4jkzA

0.19

0.15

0.83

1.66

MUSTER

---------------------------SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTT-RRGHAMLKTLMAASLEHDTAARLREGFSRPLIESVRDRLRDEIDADHAQAAADALLGAVVNAVLSEGRSYS-RQRAETSARIIVAGLRP-------

4jkzA

0.19

0.15

0.84

1.48

dPPAS

---------------------------SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTRRGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDDIDADHAQAAADALLGAVVNAVLSEGRSYS-RQRAETSARIIVAGLRP-------

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-1.14

Estimated TM-score = 0.57±0.15

Estimated RMSD = 8.0±4.4Å

Download Model 2

C-score=-1.28

Download Model 3

C-score=-1.28

Download Model 4

C-score=-4.72

Download Model 5

C-score=-2.11

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	3mnlA	0.793	1.60	0.221	0.850
2	3bjbB	0.733	1.95	0.215	0.807
3	3angC	0.681	2.84	0.138	0.817
4	2zb9A	0.670	3.00	0.181	0.822
5	2f07A	0.669	2.98	0.139	0.836
6	2id3A	0.658	3.04	0.150	0.822
7	2hxoA	0.654	2.87	0.143	0.789
8	5d1wA	0.653	3.36	0.149	0.840
9	5d18A	0.650	3.06	0.149	0.812
10	3crjA	0.649	3.10	0.163	0.807

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.13	14	3angB	DCC	Rep, Mult	124,128,138,139,142,166,170,172,173
2	0.11	9	3zqlA	QNA	Rep, Mult	52,53,54,64,65,68,73,74
3	0.07	7	5cw8A	55X	Rep, Mult	40,82,85,86,110,113,114,117,120,124,128,148,166,169,172
4	0.06	6	3zqlA	QNA	Rep, Mult	24,27,63,65,66,69,70
5	0.06	6	2uxhB	QUE	Rep, Mult	103,106,107,121,125,152,168,169,172,173,176
6	0.04	4	3aqtA	RCO	Rep, Mult	93,103,106,107,110,151,152,155
7	0.02	2	3anpA	DCC	Rep, Mult	174,178,182,183,187
8	0.02	2	3lsrA	QNA	Rep, Mult	52,53,54,58,64,65,68
9	0.01	1	3lsjB	COA	Rep, Mult	107,194,197,198
10	0.01	1	3iuv0	III	Rep, Mult	137,141,163,164,166,167,170,173,174,177,180,181,192,199,200
11	0.01	1	3anpD	DCC	Rep, Mult	37,40,41,45,46,49
12	0.01	1	3angD	DCC	Rep, Mult	33,37,41,42
13	0.01	1	2id3B	CA	Rep, Mult	55,59
14	0.01	1	2dg80	III	Rep, Mult	118,121,122,125,126,128,129,131,132,133,138,141,142,145,164,167,169,170,173,174,175,178,180,181,195,196,199,200,202
15	0.01	1	2uxpA	CLM	Rep, Mult	148,152,169,172
16	0.01	1	2id3A	CA	Rep, Mult	94,158

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	1pz2A	0.433	5.85	0.060	0.784	3.2.1.55	39
2	0.060	2epoB	0.365	5.83	0.071	0.648	3.2.1.52	NA
3	0.060	2vrkA	0.438	5.80	0.067	0.770	3.2.1.55	211
4	0.060	2ztgA	0.429	5.84	0.055	0.775	6.1.1.7	NA
5	0.060	1sznA	0.436	5.73	0.028	0.742	3.2.1.22	NA
6	0.060	2vtfA	0.447	4.93	0.037	0.690	3.2.1.96	112,116
7	0.060	1e5dA	0.428	5.40	0.054	0.700	1.-.-.-	77
8	0.060	2gjxA	0.436	5.14	0.045	0.704	3.2.1.52	NA
9	0.060	1jqnA	0.439	5.43	0.038	0.723	4.1.1.31	NA
10	0.060	1bxnA	0.443	4.89	0.090	0.681	4.1.1.39	NA
11	0.060	1px8A	0.344	5.77	0.024	0.620	3.2.1.37	NA
12	0.060	1uhvB	0.344	5.93	0.023	0.634	3.2.1.37	NA
13	0.060	2i56C	0.426	5.58	0.036	0.756	5.3.1.14	84
14	0.060	1bxnE	0.441	4.89	0.096	0.681	4.1.1.39	33,42
15	0.060	2d0tB	0.428	5.06	0.045	0.676	1.13.11.52	NA
16	0.060	2i2xA	0.464	5.17	0.046	0.737	2.1.1.90	NA
17	0.060	2vncB	0.399	5.62	0.057	0.695	3.2.1.-	80
18	0.060	2pulA	0.435	5.66	0.071	0.779	2.7.1.100	NA
19	0.060	3a47A	0.433	5.41	0.076	0.718	3.2.1.10	52,76

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.40	0.793	1.60	0.22	0.85	3mnlA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0042803
1	0.34	0.760	1.93	0.21	0.84	3bjbB	GO:0003677 GO:0006351 GO:0006355
2	0.32	0.655	3.61	0.09	0.84	2y31A	GO:0003677 GO:0006351 GO:0006355 GO:0045892
3	0.30	0.520	4.16	0.10	0.76	2oerB	GO:0003677 GO:0006351 GO:0006355
4	0.29	0.632	3.46	0.13	0.81	3e7qB	GO:0003677 GO:0003700 GO:0006351 GO:0006355
5	0.27	0.669	2.98	0.14	0.84	2f07A	GO:0003677 GO:0006351 GO:0006355
6	0.26	0.613	3.56	0.10	0.81	4l62A	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355
7	0.26	0.693	2.74	0.14	0.83	3angC	GO:0003677 GO:0006351 GO:0006355
8	0.26	0.611	3.50	0.15	0.80	3cjdA	GO:0003677 GO:0006351 GO:0006355
9	0.25	0.564	3.78	0.14	0.76	3vuqC	GO:0003677 GO:0006351 GO:0006355
10	0.24	0.612	3.30	0.16	0.79	2fq4A	GO:0003677 GO:0006351 GO:0006355
11	0.24	0.572	3.71	0.07	0.78	3on4A	GO:0003677 GO:0006351 GO:0006355
12	0.23	0.533	3.95	0.05	0.73	3vprA	GO:0003677 GO:0006351 GO:0006355 GO:0042802
13	0.23	0.636	3.54	0.10	0.82	4ichA	GO:0003677 GO:0006351 GO:0006355
14	0.22	0.640	3.19	0.11	0.80	3lwjA	GO:0003677 GO:0006351 GO:0006355
15	0.22	0.622	2.94	0.13	0.77	3bniA	GO:0003677 GO:0006351 GO:0006355
16	0.22	0.555	3.55	0.11	0.76	3dcfA	GO:0003677 GO:0006351 GO:0006355
17	0.22	0.573	3.77	0.09	0.78	2genA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
18	0.21	0.580	3.69	0.11	0.79	3he0C	GO:0003677 GO:0006351 GO:0006355
19	0.21	0.613	3.54	0.19	0.81	4jl3C	GO:0003677 GO:0006351 GO:0006355
20	0.21	0.635	3.65	0.11	0.86	1rktA	GO:0003677 GO:0006351 GO:0006355
21	0.20	0.571	3.79	0.14	0.79	3ppbA	GO:0003677 GO:0006351 GO:0006355
22	0.20	0.607	3.42	0.10	0.79	3ni7A	GO:0003677 GO:0006351 GO:0006355
23	0.20	0.609	3.72	0.16	0.81	2of7A	GO:0003677 GO:0006351 GO:0006355
24	0.20	0.592	3.83	0.10	0.79	3bruA	GO:0003677 GO:0006351 GO:0006355
25	0.20	0.586	4.00	0.12	0.83	3c2bA	GO:0003677 GO:0006351 GO:0006355
26	0.20	0.524	4.12	0.12	0.73	2q24B	GO:0003677 GO:0006351 GO:0006355
27	0.20	0.655	3.10	0.14	0.82	2hytA	GO:0003677 GO:0006351 GO:0006355
28	0.19	0.536	3.99	0.13	0.75	3vvxA	GO:0003677 GO:0006351 GO:0006355
29	0.19	0.581	3.90	0.06	0.79	2id6A	GO:0003677 GO:0006351 GO:0006355
30	0.19	0.650	3.06	0.15	0.81	5d18A	GO:0003677 GO:0006351 GO:0006355
31	0.19	0.624	3.59	0.11	0.84	3bhqA	GO:0003677 GO:0006351 GO:0006355
32	0.18	0.511	3.95	0.09	0.71	2qwtA	GO:0003677 GO:0006351 GO:0006355
33	0.18	0.658	2.86	0.14	0.79	2hxoA	GO:0003677 GO:0006351 GO:0006355 GO:0045892
34	0.18	0.582	3.78	0.13	0.77	4auxA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677 GO:0046872
35	0.18	0.571	3.78	0.10	0.78	3qkxA	GO:0003677 GO:0006351 GO:0006355
36	0.17	0.614	2.93	0.15	0.76	3bqyA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677
37	0.17	0.561	4.34	0.05	0.80	2wuiA	GO:0003677 GO:0006351 GO:0006355
38	0.17	0.560	4.14	0.04	0.77	3geuA	GO:0003677 GO:0006351 GO:0006355
39	0.17	0.630	3.82	0.13	0.85	3qbmA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
40	0.16	0.641	3.04	0.09	0.80	2dg8B	GO:0003677 GO:0006351 GO:0006355
41	0.16	0.521	4.31	0.07	0.75	4w97A	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0010468 GO:0019217
42	0.14	0.638	3.38	0.11	0.84	2qibA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
43	0.14	0.505	3.99	0.09	0.69	2ibdA	GO:0003677 GO:0006351 GO:0006355
44	0.14	0.566	4.12	0.09	0.81	3pasB	GO:0003677 GO:0006351 GO:0006355
45	0.14	0.564	4.01	0.08	0.77	3f1bA	GO:0003677 GO:0006351 GO:0006355
46	0.14	0.583	3.36	0.14	0.76	2qkoB	GO:0003677 GO:0006351 GO:0006355
47	0.12	0.513	4.39	0.06	0.74	4me9A	GO:0003677 GO:0006351 GO:0006355
48	0.12	0.574	3.69	0.11	0.76	3b81A	GO:0003677 GO:0006351 GO:0006355
49	0.12	0.555	4.25	0.09	0.78	3mvpA	GO:0003677 GO:0006351 GO:0006355
50	0.11	0.651	3.37	0.16	0.84	3htaA	GO:0003677 GO:0006351 GO:0006355
51	0.11	0.617	3.97	0.11	0.84	3g7rB	GO:0003677 GO:0003700 GO:0006351 GO:0006355
52	0.11	0.558	3.77	0.14	0.75	2g7lA	GO:0003677 GO:0006351 GO:0006355 GO:0045892
53	0.10	0.544	4.38	0.12	0.80	4jykA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0045892 GO:0045893
54	0.10	0.538	4.22	0.10	0.75	4pxiB	GO:0003677 GO:0006351 GO:0006355
55	0.10	0.660	2.70	0.13	0.78	3aqtB	GO:0003677 GO:0006351 GO:0006355
56	0.10	0.533	4.02	0.13	0.75	2o7tA	GO:0003677 GO:0006351 GO:0006355
57	0.09	0.643	3.10	0.12	0.81	2zcxA	GO:0003677 GO:0006351 GO:0006355
58	0.09	0.629	3.30	0.06	0.79	3whcA	GO:0003677 GO:0005737 GO:0006351 GO:0006355 GO:0006629 GO:0006631 GO:0016042
59	0.09	0.564	3.65	0.11	0.76	3t6nA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
60	0.08	0.635	3.21	0.13	0.80	2gfnB	GO:0003677 GO:0006351 GO:0006355
61	0.08	0.627	3.40	0.10	0.82	2nx4A	GO:0003677 GO:0006351 GO:0006355
62	0.08	0.612	3.53	0.08	0.80	1sgmA	GO:0003677 GO:0006351 GO:0006355
63	0.07	0.604	3.90	0.11	0.81	2hyjA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
64	0.07	0.651	3.50	0.15	0.84	3c07A	GO:0003677 GO:0006351 GO:0006355
65	0.07	0.600	3.70	0.17	0.81	3cwrA	GO:0003677 GO:0006351 GO:0006355
66	0.07	0.575	3.59	0.07	0.77	3knwA	GO:0003677 GO:0006351 GO:0006355
67	0.07	0.573	3.88	0.08	0.77	4gclB	GO:0003677 GO:0005737 GO:0007049 GO:0009295 GO:0010974 GO:0043565 GO:0043590 GO:0051301 GO:0051302
68	0.07	0.562	3.42	0.11	0.73	2eh3A	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0046872
69	0.07	0.544	4.14	0.07	0.76	3cdlB	GO:0003677 GO:0006351 GO:0006355
70	0.07	0.545	3.91	0.08	0.75	4gctC	GO:0000976 GO:0003677 GO:0003700 GO:0005737 GO:0005829 GO:0006355 GO:0007049 GO:0009295 GO:0010974 GO:0043565 GO:0043590 GO:0051301 GO:0051302
71	0.07	0.567	4.13	0.08	0.79	3npiA	GO:0003677 GO:0006351 GO:0006355
72	0.07	0.573	3.70	0.14	0.77	2raeA	GO:0003677 GO:0006351 GO:0006355

Consensus prediction of GO terms

Molecular Function	GO:0003700	GO:0042803	GO:0000976
GO-Score	0.57	0.40	0.40
Biological Processes	GO:0045892
GO-Score	0.32
Cellular Component	GO:0005829
GO-Score	0.40

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv0767c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]