I-TASSER results

Input Sequence in FASTA format

>protein (198 residues)
MPHESRVGRRRSTTPHHISDVAIELFAAHGFTDVSVDDIARAAGIARRTLFRYYASKNAI
PWGDFSTHLAQLQGLLDNIDSRIQLRDALRAALLAFNTFDESETIRHRKRMRVILQTPEL
QAYSMTMYAGWREVIAKFVARRSGGKTTDFMPQTVAWTMLGVALSAYEHWLRDESVSLTE
ALGAAFDVVGAGLDRLNQ

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 180 \| \| \| \| \| \| \| \| \| MPHESRVGRRRSTTPHHISDVAIELFAAHGFTDVSVDDIARAAGIARRTLFRYYASKNAIPWGDFSTHLAQLQGLLDNIDSRIQLRDALRAALLAFNTFDESETIRHRKRMRVILQTPELQAYSMTMYAGWREVIAKFVARRSGGKTTDFMPQTVAWTMLGVALSAYEHWLRDESVSLTEALGAAFDVVGAGLDRLNQ
Prediction	CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCC
Conf.Score	999886655799999999999999999989765899999999899888888768999999998888999999999997899999999999999999985666659999999999859899999999999999999999999969998876599999999999999999999689999999999999999997556899
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 180 \| \| \| \| \| \| \| \| \| MPHESRVGRRRSTTPHHISDVAIELFAAHGFTDVSVDDIARAAGIARRTLFRYYASKNAIPWGDFSTHLAQLQGLLDNIDSRIQLRDALRAALLAFNTFDESETIRHRKRMRVILQTPELQAYSMTMYAGWREVIAKFVARRSGGKTTDFMPQTVAWTMLGVALSAYEHWLRDESVSLTEALGAAFDVVGAGLDRLNQ
Prediction	856653574446512520250024003533155011420052071143000100323653414214400430251045147734224001200210142246424202201200252330142134214402410141025327544541202000100010010002101456744144002301424364375268
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160                 180

                   |                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCC
MPHESRVGRRRSTTPHHISDVAIELFAAHGFTDVSVDDIARAAGIARRTLFRYYASKNAIPWGDFSTHLAQLQGLLDNIDSRIQLRDALRAALLAFNTFDESETIRHRKRMRVILQTPELQAYSMTMYAGWREVIAKFVARRSGGKTTDFMPQTVAWTMLGVALSAYEHWLRDESVSLTEALGAAFDVVGAGLDRLNQ

2raeA

0.55

0.53

0.97

2.38

MUSTER

I------GRRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQPDDIPIVDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLDDDSLELNELLASGMQSLYDGLSSLGE

2raeA

0.55

0.53

0.97

2.30

dPPAS

------IGRRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQPDDIPIVDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLDDDSLELNELLASGMQSLYDGLSSLGE

2raeA

0.55

0.53

0.97

2.76

wdPPAS

I------GRRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQPDDIPIVDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLDDDSLELNELLASGMQSLYDGLSSLGE

2raeA

0.55

0.53

0.96

2.83

wMUSTER

-------GRRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQPDDIPIVDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLDDDSLELNELLASGMQSLYDGLSSLGE

2raeA

0.54

0.53

0.97

3.07

wPPAS

IG------RRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQPDDIPIVDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLDDDSLELNELLASGMQSLYDGLSSLGE

2raeA

0.55

0.53

0.97

3.15

dPPAS2

------IGRRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQPDDIPIVDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLDDDSLELNELLASGMQSLYDGLSSLGE

2raeA

0.55

0.53

0.97

2.76

PPAS

I------GRRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQPDDIPIVDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLDDDSLELNELLASGMQSLYDGLSSLGE

2raeA

0.55

0.53

0.97

3.02

Env-PPAS

I------GRRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQPDDIPIVDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLDDDSLELNELLASGMQSLYDGLSSLGE

4cgrA

0.23

0.22

0.93

2.03

MUSTER

V---SLTE-RRKAETREIARAAARLFVGQGLRATRAEDIARAAGVAPRTFYRYFATKEEAVAPLYALGAERWVRAVREAPAELSPPEALERAVRHTLT----PWEWARTLIRLAESSPALRKVWAEVCHSTERGLVQALAARSGGDDNSPRLHFAAAVAGASVRVAAEHWASGARSPLEQALLNLEVLR-----GFAE

4cgrA

0.24

0.22

0.94

1.98

dPPAS

---VSLTE-RRKAETREIARAAARLFVGQGLRATRAEDIARAAGVAPRTFYRYFATKEEAVAPLYALGAERWVRAVREAPAELSPPEALERAVRHTLT----PWEWARTLIRLAESSPALRKVWAEVCHSTERGLVQALAARSGGDDNSPRLHFAAAVAGASVRVAAEHWASGARSPLEQALLNLEVLRGFAWEA---

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=0.21

Estimated TM-score = 0.74±0.11

Estimated RMSD = 4.9±3.2Å

Download Model 2

C-score=-0.98

Download Model 3

C-score=0.18

Download Model 4

C-score=0.17

Download Model 5

C-score=-4.24

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	2raeA	0.922	1.44	0.542	0.970
2	2dg7A	0.731	2.95	0.213	0.909
3	4cgrA	0.714	2.95	0.209	0.889
4	1vi0A	0.674	3.48	0.113	0.874
5	3lwjA	0.672	3.35	0.109	0.889
6	2of7A	0.653	3.46	0.187	0.869
7	3cwrA	0.652	3.42	0.124	0.849
8	2uxuA	0.650	3.83	0.158	0.899
9	2w53A	0.650	3.46	0.168	0.849
10	3c07A	0.646	3.73	0.130	0.889

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.12	24	3q0uA	LL3	Rep, Mult	75,88,89,92,93,96,124,128,131,134,135,138,160,163,164,166,167,189
2	0.09	18	3q3sA	O8B	Rep, Mult	76,89,92,93,96,100,107,111,124,128,131,134,135,160,163,164,167,168,171,189
3	0.05	8	2ns8A	III	Rep, Mult	35,36,37,47,51,54,55,56,57
4	0.04	9	3br1A	DEQ	Rep, Mult	65,68,69,72,99,100,103,107,111,124,131
5	0.04	8	3angA	DCC	Rep, Mult	68,122,123,126,131,154,157,161,164
6	0.03	6	3anpD	DCC	Rep, Mult	165,168,169,173,176
7	0.03	5	1qpiA	QNA	Rep, Mult	46,48,49,52
8	0.02	5	5f0hA	5TC	Rep, Mult	61,65,72,75,88,89,93,97,124,128,131,134,160,163,167,189
9	0.02	3	3q0vA	LL4	Rep, Mult	76,84,85,88,89,92,128,134,135,138,160,163,189
10	0.02	5	3p9tA	TCL	Rep, Mult	65,68,93,114,115,127,128,131,135,159,160,163,167
11	0.01	3	3anpD	DAO	Rep, Mult	96,107,110,114,126,129,161,163,164
12	0.01	1	2rae0	III	Rep, Mult	84,85,86,122,143,148,149,150,151,153,154,155,157,158,161,164,165,168,169,181,189,190,191,192,193,196,197,198
13	0.01	2	3lsrA	NUC	Rep, Mult	2,7,35,36,37,41,47,48,51
14	0.01	2	3btiA	BER	Rep, Mult	68,71,72,75,96,99,103,128,131
15	0.01	2	3lsrA	QNA	Rep, Mult	35,36,37,41,47,48,51
16	0.01	2	3angB	DCC	Rep, Mult	169,173,176,177,180,184
17	0.01	2	2zozA	ET	Rep, Mult	171,172
18	0.00	1	3lsjA	COA	Rep, Mult	85,88,144,190,191,194
19	0.00	1	3lsjA	COA	Rep, Mult	195,196,197
20	0.00	1	2np5A	NDS	Rep, Mult	63,66

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	1bucB	0.394	4.49	0.090	0.591	1.3.99.2	53
2	0.060	2qq5A	0.451	4.64	0.028	0.677	1.1.-.-	NA
3	0.060	2osxA	0.449	5.50	0.076	0.748	3.2.1.123	34
4	0.060	2uxwA	0.455	5.41	0.066	0.737	1.3.99.-	NA
5	0.060	1j0aA	0.458	4.83	0.085	0.712	3.5.99.7,4.1.99.4	NA
6	0.060	1jqiA	0.463	4.76	0.066	0.712	1.3.99.2	NA
7	0.060	1h7aA	0.467	5.01	0.086	0.737	1.17.4.2	NA
8	0.060	1peuA	0.449	5.08	0.061	0.763	1.17.4.1	NA
9	0.060	5r1rA	0.451	5.44	0.078	0.783	1.17.4.1	NA
10	0.060	1o58A	0.451	4.50	0.086	0.682	2.5.1.47	NA
11	0.060	2pulA	0.493	4.64	0.055	0.737	2.7.1.100	NA
12	0.060	1xjjA	0.453	5.32	0.060	0.773	1.17.4.1	39
13	0.060	1h16A	0.492	4.87	0.044	0.763	2.3.1.54	NA
14	0.060	1rx0A	0.453	4.80	0.044	0.687	1.3.99.-	NA
15	0.060	2pflA	0.489	4.90	0.055	0.763	2.3.1.54	153,155
16	0.060	2d0tB	0.460	5.46	0.026	0.793	1.13.11.52	52
17	0.060	1z7wA	0.451	4.80	0.063	0.712	2.5.1.47	NA
18	0.060	2q3dA	0.449	4.76	0.100	0.697	2.5.1.47	NA
19	0.060	1rqxC	0.478	4.52	0.067	0.727	3.5.99.7	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.45	0.922	1.44	0.54	0.97	2raeA	GO:0003677 GO:0006351 GO:0006355
1	0.32	0.674	3.47	0.18	0.90	2of7A	GO:0003677 GO:0006351 GO:0006355
2	0.30	0.651	3.84	0.17	0.89	3lhqA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
3	0.27	0.616	3.74	0.13	0.82	2hytA	GO:0003677 GO:0006351 GO:0006355
4	0.26	0.604	4.03	0.16	0.85	2np5A	GO:0003677 GO:0006351 GO:0006355
5	0.25	0.735	2.94	0.21	0.91	2dg7A	GO:0003677 GO:0006351 GO:0006355
6	0.25	0.593	4.09	0.11	0.84	2f07A	GO:0003677 GO:0006351 GO:0006355
7	0.24	0.580	4.25	0.11	0.83	4g12A	GO:0003677 GO:0006351 GO:0006355
8	0.24	0.617	3.97	0.15	0.86	3vprA	GO:0003677 GO:0006351 GO:0006355 GO:0042802
9	0.24	0.563	3.92	0.10	0.80	4aciB	GO:0000287 GO:0003677 GO:0006351 GO:0006355 GO:0046872
10	0.22	0.623	3.69	0.12	0.84	3bhqA	GO:0003677 GO:0006351 GO:0006355
11	0.21	0.656	3.69	0.18	0.88	3vibC	GO:0003677 GO:0006351 GO:0006355
12	0.21	0.585	4.31	0.14	0.86	3ppbA	GO:0003677 GO:0006351 GO:0006355
13	0.21	0.612	3.84	0.16	0.83	2np3B	GO:0003677 GO:0006351 GO:0006355
14	0.21	0.687	3.44	0.10	0.90	3lwjA	GO:0003677 GO:0006351 GO:0006355
15	0.20	0.581	4.01	0.07	0.81	1jt0A	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0045892
16	0.20	0.719	2.95	0.20	0.89	4cgrA	GO:0003677 GO:0006351 GO:0006355
17	0.19	0.574	4.05	0.05	0.80	3aqtB	GO:0003677 GO:0006351 GO:0006355
18	0.19	0.571	4.11	0.10	0.82	2y31A	GO:0003677 GO:0006351 GO:0006355 GO:0045892
19	0.19	0.588	4.68	0.14	0.89	3ccyA	GO:0003677 GO:0006351 GO:0006355
20	0.19	0.623	3.75	0.09	0.84	4l62A	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355
21	0.18	0.641	3.95	0.20	0.90	3bcgA	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0008144 GO:0042493 GO:0043565 GO:0045892
22	0.18	0.525	4.28	0.12	0.78	2zozB	GO:0003677 GO:0006351 GO:0006355
23	0.18	0.534	4.21	0.10	0.76	2q24B	GO:0003677 GO:0006351 GO:0006355
24	0.17	0.527	4.64	0.10	0.79	3b81A	GO:0003677 GO:0006351 GO:0006355
25	0.17	0.568	4.32	0.12	0.85	2wuiA	GO:0003677 GO:0006351 GO:0006355
26	0.17	0.601	4.24	0.07	0.86	3on4A	GO:0003677 GO:0006351 GO:0006355
27	0.17	0.622	3.97	0.09	0.87	2qibA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
28	0.17	0.616	3.33	0.14	0.81	2eh3A	GO:0003677 GO:0003700 GO:0006351 GO:0006355 GO:0046872
29	0.16	0.619	4.11	0.11	0.87	1rktA	GO:0003677 GO:0006351 GO:0006355
30	0.16	0.638	3.72	0.15	0.87	3angC	GO:0003677 GO:0006351 GO:0006355
31	0.16	0.556	4.67	0.16	0.86	3dewA	GO:0003677 GO:0006351 GO:0006355 GO:0016020 GO:0016021
32	0.16	0.551	4.45	0.06	0.80	2o7tA	GO:0003677 GO:0006351 GO:0006355
33	0.15	0.577	4.09	0.11	0.80	3mvpA	GO:0003677 GO:0006351 GO:0006355
34	0.15	0.548	4.36	0.04	0.83	2zcnD	GO:0003677 GO:0006351 GO:0006355
35	0.15	0.590	4.28	0.09	0.87	2pbxA
36	0.15	0.618	3.74	0.14	0.84	2genA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
37	0.15	0.561	4.54	0.12	0.83	2ibdA	GO:0003677 GO:0006351 GO:0006355
38	0.13	0.574	4.26	0.09	0.84	5d1wD	GO:0003677 GO:0006351 GO:0006355
39	0.12	0.550	4.65	0.09	0.84	4me9A	GO:0003677 GO:0006351 GO:0006355
40	0.12	0.582	4.41	0.11	0.85	3pasB	GO:0003677 GO:0006351 GO:0006355
41	0.12	0.620	4.07	0.08	0.88	3g7rB	GO:0003677 GO:0003700 GO:0006351 GO:0006355
42	0.12	0.544	4.37	0.13	0.81	2oerB	GO:0003677 GO:0006351 GO:0006355
43	0.12	0.512	4.84	0.11	0.82	3vvxA	GO:0003677 GO:0006351 GO:0006355
44	0.10	0.664	3.70	0.13	0.91	3c07A	GO:0003677 GO:0006351 GO:0006355
45	0.10	0.660	3.46	0.13	0.86	3cwrA	GO:0003677 GO:0006351 GO:0006355
46	0.10	0.566	4.55	0.09	0.86	3kz9B	GO:0003677 GO:0006351 GO:0006355
47	0.09	0.683	3.34	0.10	0.88	3whcA	GO:0003677 GO:0005737 GO:0006351 GO:0006355 GO:0006629 GO:0006631 GO:0016042
48	0.08	0.605	3.84	0.11	0.84	3bjbB	GO:0003677 GO:0006351 GO:0006355
49	0.08	0.611	4.03	0.11	0.85	3bruA	GO:0003677 GO:0006351 GO:0006355
50	0.08	0.607	4.44	0.17	0.91	2fbqA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0044212 GO:0045893 GO:0050714
51	0.07	0.630	3.40	0.09	0.82	1sgmA	GO:0003677 GO:0006351 GO:0006355
52	0.07	0.635	3.60	0.13	0.84	4yzeA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0045892
53	0.07	0.599	3.93	0.08	0.84	3dpjA	GO:0003677 GO:0006351 GO:0006355
54	0.07	0.592	4.48	0.13	0.87	3s5rA	GO:0003677 GO:0006351 GO:0006355
55	0.07	0.607	4.31	0.10	0.89	2id6A	GO:0003677 GO:0006351 GO:0006355
56	0.07	0.569	4.20	0.13	0.82	3dcfA	GO:0003677 GO:0006351 GO:0006355
57	0.07	0.601	3.60	0.11	0.80	3knwA	GO:0003677 GO:0006351 GO:0006355
58	0.07	0.601	3.77	0.12	0.83	3cdlB	GO:0003677 GO:0006351 GO:0006355
59	0.07	0.593	3.84	0.07	0.81	3f0cA	GO:0003677 GO:0006351 GO:0006355
60	0.07	0.594	4.14	0.10	0.85	3qbmA	GO:0003677 GO:0003700 GO:0006351 GO:0006355
61	0.07	0.591	4.19	0.14	0.84	3himB	GO:0003677 GO:0006351 GO:0006355
62	0.07	0.582	4.38	0.17	0.86	3f1bA	GO:0003677 GO:0006351 GO:0006355
63	0.07	0.591	4.38	0.14	0.87	5f1jA	GO:0003677 GO:0006351 GO:0006355
64	0.07	0.594	4.00	0.11	0.82	3bqyA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677
65	0.07	0.579	3.93	0.15	0.82	2zb9A	GO:0003677 GO:0006351 GO:0006355
66	0.07	0.584	4.11	0.15	0.85	4nn1A	GO:0003677 GO:0003700 GO:0006351 GO:0006355
67	0.07	0.559	4.30	0.10	0.81	2fd5A	GO:0003677 GO:0003700 GO:0006351 GO:0006355
68	0.07	0.599	4.10	0.11	0.85	4jykA	GO:0000976 GO:0003677 GO:0003700 GO:0005829 GO:0006351 GO:0006355 GO:0045892 GO:0045893
69	0.07	0.588	4.22	0.07	0.84	3npiA	GO:0003677 GO:0006351 GO:0006355
70	0.07	0.589	4.24	0.11	0.86	5d18A	GO:0003677 GO:0006351 GO:0006355
71	0.07	0.599	3.93	0.11	0.83	2fq4A	GO:0003677 GO:0006351 GO:0006355
72	0.07	0.557	4.25	0.11	0.83	2iu5A	GO:0003677 GO:0006351 GO:0006355
73	0.07	0.566	4.28	0.11	0.84	2zcxA	GO:0003677 GO:0006351 GO:0006355
74	0.07	0.552	4.20	0.13	0.82	4jl3C	GO:0003677 GO:0006351 GO:0006355
75	0.07	0.555	4.41	0.10	0.82	3nnrA	GO:0003677 GO:0006351 GO:0006355
76	0.07	0.580	4.28	0.11	0.83	4auxA	GO:0003677 GO:0006351 GO:0006355 GO:0045892 GO:0046677 GO:0046872
77	0.07	0.526	4.50	0.10	0.77	2i10B	GO:0003677 GO:0006351 GO:0006355
78	0.07	0.585	4.49	0.13	0.85	4pxiB	GO:0003677 GO:0006351 GO:0006355
79	0.07	0.557	4.54	0.10	0.83	3geuA	GO:0003677 GO:0006351 GO:0006355
80	0.07	0.541	4.60	0.12	0.84	3he0C	GO:0003677 GO:0006351 GO:0006355
81	0.07	0.516	5.26	0.12	0.86	3nrgA	GO:0003677 GO:0003700 GO:0006351 GO:0006355

Consensus prediction of GO terms

Molecular Function	GO:0003677	GO:0003700
GO-Score	0.86	0.30
Biological Processes	GO:0006355
GO-Score	0.86
Cellular Component
GO-Score

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv0691c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]