I-TASSER results

Input Sequence in FASTA format

>protein (99 residues)
MIARYRAGAELFLACAALAGSAASWSRTRSTVAVAPVIDGQPVTLSVVYHPQPLVLTLLL
ATIAGVLSVVGTARLRRARAGLNAHPDGLNQRPPGGWCH

Predicted Secondary Structure

Sequence	20 40 60 80 \| \| \| \| MIARYRAGAELFLACAALAGSAASWSRTRSTVAVAPVIDGQPVTLSVVYHPQPLVLTLLLATIAGVLSVVGTARLRRARAGLNAHPDGLNQRPPGGWCH
Prediction	CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEHCCCCCCCCCEEEEEHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
Conf.Score	987556899999999999999999998687588756789998668999867579999999999989999998777656657899987778899998899
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 \| \| \| \| MIARYRAGAELFLACAALAGSAASWSRTRSTVAVAPVIDGQPVTLSVVYHPQPLVLTLLLATIAGVLSVVGTARLRRARAGLNAHPDGLNQRPPGGWCH
Prediction	745534110200121122211011123443313033236453433333343331211133333333110222130343475674447525744554338
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80

                   |                   |                   |                   |

Sec.Str
Seq

CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEHCCCCCCCCCEEEEEHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
MIARYRAGAELFLACAALAGSAASWSRTRSTVAVAPVIDGQPVTLSVVYHPQPLVLTLLLATIAGVLSVVGTARLRRARAGLNAHPDGLNQRPPGGWCH

4v1fA

0.19

0.15

0.82

0.79

MUSTER

MELDPNALITAGALIGGGLIMGGGAIGAGDGIAGNALISGQPEAQGRLF--TPFFITVGLVEAAYFINLAFMALFVFATPGLQ----------------

2ndjA

0.10

1.00

0.92

dPPAS

TNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSM

2ndjA

0.13

0.98

0.83

wdPPAS

MNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLP-DDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRS-DPYHVYIKNRVSM

4v1fA

0.20

0.16

0.82

0.80

wMUSTER

LDPNALITAGALIGGGLIMGGGAIGAGIGDGIAGNALISGQPEAQGRLF--TPFFITVGLVEAAYFINLAFMALFVFATPGLQ----------------

2n4pA

0.26

0.18

0.70

0.71

wPPAS

MAGSHHHHHH---------GSMSEY------IRVTEDENDEPIEIPSEDDG-----TVLLSTVTAQF---GACGLRR-------NPVSQCMRPDAGWVN

2ndjA

0.12

0.99

0.84

dPPAS2

TNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRS-DPYHVYIKNRVSM

2ndjA

0.13

0.98

0.99

PPAS

MNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLP-DDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRS-DPYHVYIKNRVSM

2wuqA1

0.25

0.23

0.93

0.86

Env-PPAS

T----ASLVKLPLALATLERIRLGEVDGAQQIEVAPITTPGPTGLSRFRHPDLLYLSTSVGTASDALFEIPPAQVEQMRHSMREHRVQLDARANTG---

4f4cA1

0.15

0.13

0.85

0.79

MUSTER

----GLPLMSILQGKVSQAFINEQIVINNNGSTFLP--TGQNYTKT-DFEHDVMNVVWSYAAMTSVLYLLNTCAYRMGLALIITDPPTM--QP------

5awwG

0.05

0.04

0.76

0.68

dPPAS

--MDLLYTLVILFYLGVAGLLVYLVLVQEPKQGAGDLMGGSADLFSARGVTGGLYRLTVILGVVFAALALVIGLWPR----------------------

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-2.49

Estimated TM-score = 0.42±0.14

Estimated RMSD = 9.3±4.6Å

Download Model 2

C-score=-3.01

Download Model 3

C-score=-4.33

Download Model 4

C-score=-2.68

Download Model 5

C-score=-4.89

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	3i9wA2	0.681	2.91	0.082	0.929
2	3i2wB	0.677	2.82	0.043	0.909
3	3k29A	0.662	2.40	0.021	0.838
4	4e40A	0.659	3.60	0.103	0.980
5	4av3A	0.658	3.13	0.084	0.909
6	3fppB	0.657	3.28	0.041	0.899
7	4o5jA	0.655	3.37	0.041	0.960
8	2f1mC	0.653	3.62	0.082	0.929
9	2y44A	0.652	3.62	0.122	0.980
10	4tkoB	0.650	3.59	0.041	0.950

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.36	81	3bknC	HEM	Rep, Mult	18,21,22,25,62,66,69,70,72,73
2	0.04	9	3gvyC	HEM	Rep, Mult	18,25,69,70,72,73
3	0.03	7	4m70A	III	Rep, Mult	24,27,64,68
4	0.03	7	1mz9B	VDY	Rep, Mult	67,70,74
5	0.02	4	4tt0A	IOD	Rep, Mult	73,74,77
6	0.02	4	4retB	17F	Rep, Mult	58,59,62,66
7	0.01	3	2kp8B	XIG	Rep, Mult	17,18,19,75,76,78,79,82
8	0.01	3	4brbC	78N	Rep, Mult	32,35,54,62
9	0.01	2	5l1gC	GYB	Rep, Mult	63,66,67,70
10	0.01	2	3mmhB	MG	Rep, Mult	53,54
11	0.00	1	1izlC	CLA	Rep, Mult	8,11,12,13,15,16
12	0.00	1	2wsc1	CLA	Rep, Mult	7,10
13	0.00	1	3arcc	CA	Rep, Mult	60,62,67,68
14	0.00	1	1kyoE	SMA	Rep, Mult	98,99
15	0.00	1	3m9iA	3PE	Rep, Mult	22,26
16	0.00	1	2wycA	3LA	Rep, Mult	57,60
17	0.00	1	3rrpA	LMR	Rep, Mult	34,35,38,47,50,56
18	0.00	1	2o01G	CLA	Rep, Mult	42,46
19	0.00	1	4amjB	2CV	Rep, Mult	1,6

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.144	1urfA	0.539	2.93	0.092	0.758	2.7.11.13	14,18
2	0.120	1wu0A	0.499	2.79	0.114	0.697	3.6.3.14	NA
3	0.112	2w5jA	0.540	2.60	0.092	0.768	3.6.3.14	NA
4	0.101	1a91A	0.571	2.51	0.078	0.778	3.6.3.14	NA
5	0.075	1cxzB	0.532	2.31	0.088	0.687	2.7.11.13	NA
6	0.060	1xzpA	0.590	3.65	0.074	0.919	3.6.5.-	NA
7	0.060	1yfeA	0.626	3.63	0.122	0.929	4.2.1.2	NA
8	0.060	1dcnB	0.582	3.12	0.116	0.849	4.3.2.1	NA
9	0.060	1dofA	0.603	3.25	0.064	0.869	4.3.2.2	NA
10	0.060	2zr3B	0.566	3.21	0.043	0.828	6.1.1.11	NA
11	0.060	1a31A	0.386	3.85	0.026	0.667	5.99.1.2	NA
12	0.060	1yfmA	0.597	3.43	0.054	0.889	4.2.1.2	NA
13	0.060	1i0aA	0.578	3.13	0.107	0.838	4.3.2.1	NA
14	0.060	2occN	0.606	3.63	0.063	0.919	1.9.3.1	NA
15	0.060	1m56A	0.605	3.66	0.053	0.919	1.9.3.1	77
16	0.060	1qleA	0.599	3.74	0.042	0.929	1.9.3.1	77
17	0.060	3czoB	0.546	3.68	0.097	0.828	4.3.1.3	NA
18	0.060	1k7wD	0.590	3.03	0.105	0.849	4.3.2.1	NA
19	0.060	1sc7A	0.615	2.79	0.061	0.798	5.99.1.2	NA
20	0.060	3e04D	0.581	3.74	0.034	0.859	4.2.1.2	NA
21	0.060	1fftA	0.578	3.86	0.095	0.929	1.10.3.-	NA
22	0.060	1eiyA	0.577	2.85	0.045	0.788	6.1.1.20	NA
23	0.060	3ikmD	0.569	3.62	0.000	0.909	2.7.7.7	NA
24	0.060	2iw5A	0.609	3.14	0.063	0.849	1.-.-.-	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.16	0.662	2.40	0.02	0.84	3k29A	GO:0042802
1	0.14	0.590	3.00	0.07	0.81	3p30A
2	0.13	0.641	2.77	0.05	0.84	4bneA	GO:0005737 GO:0005768 GO:0005769 GO:0005802 GO:0005829 GO:0005856 GO:0005886 GO:0005901 GO:0005925 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0030036 GO:0030054 GO:0030100 GO:0030659 GO:0031410 GO:0032587 GO:0042995 GO:0045806 GO:0055038 GO:0070300 GO:0070836 GO:0097320
3	0.13	0.610	3.18	0.07	0.91	3q0kD	GO:0005215 GO:0005654 GO:0005737 GO:0005768 GO:0005769 GO:0005829 GO:0005856 GO:0005886 GO:0005901 GO:0005911 GO:0005913 GO:0005925 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019898 GO:0030036 GO:0030100 GO:0030659 GO:0031410 GO:0032587 GO:0036010 GO:0042802 GO:0042995 GO:0043231 GO:0045806 GO:0048858 GO:0055038 GO:0070062 GO:0070300 GO:0070836 GO:0072584 GO:0097320 GO:0098609 GO:0098641
4	0.13	0.606	3.13	0.03	0.91	3i2wA	GO:0000281 GO:0005543 GO:0005768 GO:0005829 GO:0005886 GO:0007053 GO:0007112 GO:0007269 GO:0008289 GO:0030100 GO:0030496 GO:0032154 GO:0036090 GO:0045211 GO:0045887 GO:0048488 GO:0061024 GO:0071212
5	0.11	0.488	3.81	0.05	0.78	2ezoA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
6	0.11	0.673	2.96	0.09	0.92	3syvC	GO:0005654 GO:0005737 GO:0005768 GO:0005802 GO:0005886 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019855 GO:0045806 GO:0051044 GO:0051926 GO:0070062 GO:0097320
7	0.11	0.590	2.78	0.12	0.82	3wfvA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
8	0.11	0.541	2.70	0.07	0.72	3k9aA
9	0.10	0.604	3.29	0.07	0.91	3syvB	GO:0005654 GO:0005737 GO:0005768 GO:0005802 GO:0005886 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019855 GO:0045806 GO:0051044 GO:0051926 GO:0070062 GO:0097320
10	0.09	0.681	2.91	0.08	0.93	3i9wA	GO:0000155 GO:0000160 GO:0000166 GO:0004673 GO:0004721 GO:0004871 GO:0005524 GO:0005622 GO:0005886 GO:0006470 GO:0007165 GO:0009061 GO:0016020 GO:0016021 GO:0016301 GO:0016310 GO:0016740 GO:0016772 GO:0016868 GO:0018106 GO:0023014 GO:0046777 GO:0071310
11	0.09	0.561	3.27	0.06	0.82	1envA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0002223 GO:0003677 GO:0003682 GO:0003700 GO:0005198 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0019064 GO:0019082 GO:0020002 GO:0030683 GO:0033644 GO:0039654 GO:0039663 GO:0042802 GO:0043565 GO:0044174 GO:0044175 GO:0045899 GO:0046718 GO:0055036 GO:0060261 GO:0075509 GO:0075512 GO:1903833
12	0.09	0.506	2.59	0.09	0.66	3cp1A	GO:0005198 GO:0019031
13	0.09	0.613	3.27	0.03	0.92	3i2wB	GO:0000281 GO:0005543 GO:0005768 GO:0005829 GO:0005886 GO:0007053 GO:0007112 GO:0007269 GO:0008289 GO:0030100 GO:0030496 GO:0032154 GO:0036090 GO:0045211 GO:0045887 GO:0048488 GO:0061024 GO:0071212
14	0.07	0.603	3.26	0.06	0.90	2eflA	GO:0005086 GO:0005737 GO:0005764 GO:0005802 GO:0005856 GO:0005886 GO:0005905 GO:0005938 GO:0006897 GO:0008289 GO:0016020 GO:0016023 GO:0016192 GO:0031410 GO:0042802 GO:0043547
15	0.07	0.635	3.34	0.04	0.91	2efkA	GO:0001891 GO:0005086 GO:0005096 GO:0005654 GO:0005737 GO:0005764 GO:0005794 GO:0005802 GO:0005829 GO:0005856 GO:0005886 GO:0005938 GO:0006897 GO:0007154 GO:0007165 GO:0008289 GO:0016020 GO:0016192 GO:0030036 GO:0042802 GO:0042995 GO:0043231 GO:0043547 GO:0048471 GO:0051056 GO:0070062
16	0.07	0.561	3.76	0.08	0.88	1qbzA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
17	0.07	0.581	3.32	0.11	0.89	4wpeA	GO:0000142 GO:0000144 GO:0000281 GO:0000917 GO:0005737 GO:0005856 GO:0005935 GO:0007049 GO:0007067 GO:0008092 GO:0044697 GO:0051301 GO:0090339
18	0.07	0.597	3.39	0.05	0.92	3m3wB	GO:0005654 GO:0005737 GO:0005768 GO:0005802 GO:0005886 GO:0006897 GO:0008092 GO:0008289 GO:0016020 GO:0019855 GO:0045806 GO:0051044 GO:0051926 GO:0070062 GO:0097320
19	0.07	0.609	3.19	0.08	0.84	1u4qA	GO:0003779 GO:0005509 GO:0005516 GO:0005737 GO:0005856 GO:0005938 GO:0046872 GO:0051693
20	0.07	0.693	2.76	0.07	0.92	3qniA	GO:0005543 GO:0005737 GO:0005768 GO:0005829 GO:0005886 GO:0006897 GO:0007015 GO:0008092 GO:0008289 GO:0016020 GO:0030054 GO:0030100 GO:0030137 GO:0030659 GO:0031410 GO:0032587 GO:0042995 GO:0043005 GO:0043209 GO:0043679 GO:0045202 GO:0045806 GO:0048471 GO:0048488 GO:0048666 GO:0048812 GO:0072657 GO:0090002 GO:0097320 GO:1900006
21	0.07	0.620	3.19	0.05	0.92	3haiA	GO:0005543 GO:0005737 GO:0005768 GO:0005829 GO:0005886 GO:0006897 GO:0007015 GO:0008092 GO:0008289 GO:0016020 GO:0030054 GO:0030100 GO:0030137 GO:0030659 GO:0031410 GO:0032587 GO:0042995 GO:0043005 GO:0043209 GO:0043679 GO:0045202 GO:0045806 GO:0048471 GO:0048488 GO:0048666 GO:0048812 GO:0072657 GO:0090002 GO:0097320 GO:1900006
22	0.07	0.609	3.43	0.05	0.91	5c1fA	GO:0001786 GO:0005547 GO:0005737 GO:0005826 GO:0005829 GO:0005856 GO:0007049 GO:0007067 GO:0051301 GO:0070273 GO:1903475
23	0.07	0.628	2.89	0.06	0.85	3o1jA	GO:0000155 GO:0000160 GO:0000166 GO:0004673 GO:0004871 GO:0005524 GO:0005622 GO:0007165 GO:0016020 GO:0016021 GO:0016301 GO:0016310 GO:0016740 GO:0016772 GO:0018106 GO:0023014
24	0.07	0.542	3.37	0.06	0.80	3v47C	GO:0005198 GO:0005576 GO:0009288 GO:0009420 GO:0071973
25	0.07	0.607	3.44	0.08	0.89	3i9yA	GO:0000155 GO:0000160 GO:0000166 GO:0004673 GO:0004871 GO:0005524 GO:0005622 GO:0007165 GO:0016020 GO:0016021 GO:0016301 GO:0016310 GO:0016740 GO:0016772 GO:0018106 GO:0023014

Consensus prediction of GO terms

Molecular Function	GO:0005515	GO:0043168	GO:0008289
GO-Score	0.54	0.49	0.34
Biological Processes	GO:0051051	GO:0051129	GO:1902589	GO:0007010	GO:0044854	GO:0030029	GO:0030100
GO-Score	0.49	0.49	0.49	0.49	0.49	0.49	0.34
Cellular Component	GO:0044853	GO:0001726	GO:0031253	GO:0012506	GO:0055037	GO:0005924	GO:0044433	GO:0043232	GO:0016023	GO:0031256	GO:0010008	GO:0005829
GO-Score	0.49	0.49	0.49	0.49	0.49	0.49	0.49	0.49	0.49	0.49	0.49	0.34

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv0514

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]