I-TASSER results

Input Sequence in FASTA format

>protein (33 residues)
MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK

Predicted Secondary Structure

Sequence	20 \| MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK
Prediction	CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Conf.Score	975889999999899999999999999999789
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 \| MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK
Prediction	855425544654556424522553435556478
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20

                   |

Sec.Str
Seq

CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK

5aj3n

0.44

0.42

0.97

1.16

MUSTER

-KNILKIRRRKMNHHKYRKLVKRTRFLRRKVRE

2qdqA

0.16

0.15

0.97

1.17

dPPAS

IAQIIAAQEEMLRKERELEEARKKLAQIRQQQ-

3a1gB

0.27

1.00

1.29

wdPPAS

GGSERIKELRNLSQSRTREILTKTTVDHAIIKK

5aj3n

0.45

0.42

0.94

1.13

wMUSTER

--NILKIRRRKMNHHKYRKLVKRTRFLRRKVRE

3a1gB

0.27

1.00

1.29

wPPAS

GGSERIKELRNLSQSRTREILTKTTVDHAIIKK

5aj3n

0.44

0.42

0.97

1.30

dPPAS2

-KNILKIRRRKMNHHKYRKLVKRTRFLRRKVRE

3a1gB

0.27

1.00

1.49

PPAS

GGSERIKELRNLSQSRTREILTKTTVDHAIIKK

4pndA

0.20

0.18

0.91

1.39

Env-PPAS

-GN-ILQKIENILKKIENILWKIENILQKIEG-

2f4mA2

0.21

1.00

0.67

MUSTER

INGLNKQRQLSLSESRRKELLQRIIVELVEFIS

3a1gB

0.27

1.00

1.16

dPPAS

GGSERIKELRNLSQSRTREILTKTTVDHAIIKK

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-0.33

Estimated TM-score = 0.67±0.13

Estimated RMSD = 2.5±1.9Å

Download Model 2

C-score=-2.83

Download Model 3

C-score=-4.16

Download Model 4

C-score=-1.86

Download Model 5

C-score=-0.01

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	2qupA	0.946	0.35	0.182	1.000
2	3q8tA	0.945	0.36	0.061	1.000
3	2npsD	0.944	0.37	0.061	1.000
4	2b9cB	0.941	0.37	0.152	1.000
5	3qneA	0.936	0.40	0.182	1.000
6	1wqgA	0.931	0.41	0.061	1.000
7	4zqaA	0.930	0.41	0.091	1.000
8	2yl4A1	0.930	0.41	0.091	1.000
9	5azoA	0.927	0.41	0.121	1.000
10	1gl2A	0.927	0.42	0.030	1.000

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.13	550	2wscB	CLA	Rep, Mult	16,19,20,22,23,25,26
2	0.12	571	4rqiA	III	Rep, Mult	13,14,15,16,19
3	0.10	500	4eoyA	CA	Rep, Mult	8,9,10,11,12,13
4	0.09	440	4dv1T	MG	Rep, Mult	6,7,8,9,10,11
5	0.09	445	3jcuI	CLA	Rep, Mult	11,12,13,15,16,17,19
6	0.08	376	2xi3A	GTP	Rep, Mult	18,19,22,23,26
7	0.05	252	2q7mB	2CS	Rep, Mult	14,16,17,18,20,21
8	0.04	197	1i94T	MG	Rep, Mult	2,3,4,5,6,7
9	0.04	233	1dpmA	EBP	Rep, Mult	24,25,28,29
10	0.03	156	2fbhA	ZN	Rep, Mult	26,27,28,31
11	0.02	117	5t6jA	III	Rep, Mult	1,4,5,7,8,11
12	0.02	100	3a0hB	IOD	Rep, Mult	28,29,30,32

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.446	1ybzA	0.835	0.69	0.061	1.000	5.4.99.5	9
2	0.269	3brvC	0.768	1.41	0.031	0.939	2.7.11.10	21
3	0.224	2h8nA	0.876	0.59	0.121	1.000	3.5.1.98	13,20
4	0.204	2jwaA	0.750	1.39	0.094	0.939	2.7.10.1	NA
5	0.202	1r7cA	0.608	2.23	0.065	0.939	3.6.1.15	NA
6	0.201	3brtA	0.709	1.61	0.063	0.939	2.7.11.10	21
7	0.187	1qleD	0.748	1.08	0.061	1.000	1.9.3.1	8
8	0.166	1vzjF	0.607	1.28	0.094	0.970	3.1.1.7	27
9	0.162	2k1lA	0.516	2.08	0.161	0.909	2.7.10.1	NA
10	0.156	1xtcC	0.764	0.91	0.091	1.000	2.4.2.36	NA
11	0.134	1z8yN	0.667	1.28	0.061	1.000	3.4.21.90	26
12	0.111	1ecmB	0.873	1.30	0.061	1.000	4.2.1.51,5.4.99.5	9
13	0.067	1k1fA	0.780	1.19	0.061	0.879	2.7.11.1	27
14	0.067	2o98P	0.707	1.60	0.061	0.849	3.6.3.6	NA
15	0.060	2uz5A	0.588	0.89	0.160	0.727	5.2.1.8	NA
16	0.060	3cq0A	0.897	0.52	0.091	1.000	2.2.1.2	NA
17	0.060	3hm8A	0.873	0.60	0.061	1.000	2.7.1.1	NA
18	0.060	1eumE	0.849	1.15	0.061	1.000	1.16.3.1	13
19	0.060	2ow6A	0.863	1.04	0.030	1.000	3.2.1.114	NA
20	0.060	2ahmE	0.676	1.94	0.100	0.879	2.7.7.48	NA
21	0.060	1aamA	0.777	0.90	0.061	1.000	2.6.1.1	NA
22	0.060	3e7kH	0.906	0.50	0.091	1.000	2.7.11.1	NA
23	0.060	1cxzB	0.896	0.55	0.212	1.000	2.7.11.13	9,16,20
24	0.060	1xdpA	0.843	1.12	0.061	1.000	2.7.4.1	NA
25	0.060	1c3cA	0.862	0.69	0.121	1.000	4.3.2.2	NA
26	0.060	1x75B	0.736	1.18	0.033	0.879	5.99.1.3	21
27	0.060	1mhyB	0.856	0.62	0.030	1.000	1.14.13.25	NA
28	0.060	1is2A	0.862	0.65	0.030	1.000	1.3.3.6	NA
29	0.060	1wt6B	0.889	0.54	0.152	1.000	2.7.11.1	11,13
30	0.060	3k9fA	0.882	0.56	0.091	1.000	5.99.1.-	NA
31	0.060	3e08A	0.851	1.04	0.121	1.000	1.13.11.11	NA
32	0.060	3bfrA	0.860	0.70	0.030	0.970	1.15.1.1	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.45	0.892	0.54	0.06	1.00	5appB	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
1	0.42	0.851	0.83	0.09	1.00	3gjpA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
2	0.40	0.910	0.49	0.03	1.00	2efrA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0003779 GO:0005634 GO:0005667 GO:0005737 GO:0005856 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
3	0.40	0.898	0.52	0.06	1.00	2wpqA	GO:0009405 GO:0019867
4	0.39	0.874	0.57	0.12	1.00	2ipzA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
5	0.39	0.844	0.64	0.19	0.97	1w5jA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
6	0.39	0.914	0.47	0.12	1.00	1gk6A	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0001948 GO:0003677 GO:0003682 GO:0003700 GO:0003725 GO:0005198 GO:0005200 GO:0005212 GO:0005634 GO:0005667 GO:0005737 GO:0005777 GO:0005829 GO:0005856 GO:0005882 GO:0005886 GO:0005925 GO:0006351 GO:0006355 GO:0006366 GO:0006928 GO:0008022 GO:0008652 GO:0010628 GO:0010691 GO:0010977 GO:0014002 GO:0016032 GO:0030049 GO:0031012 GO:0031252 GO:0042802 GO:0042995 GO:0043005 GO:0043565 GO:0045103 GO:0045109 GO:0045111 GO:0045899 GO:0060020 GO:0060261 GO:0060395 GO:0070062 GO:0070307 GO:0097110 GO:1903833 GO:1990254
7	0.39	0.856	0.65	0.09	1.00	2n9bA	GO:0000122 GO:0000166 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0001726 GO:0003677 GO:0003682 GO:0003700 GO:0003774 GO:0003779 GO:0005516 GO:0005524 GO:0005547 GO:0005634 GO:0005667 GO:0005737 GO:0005829 GO:0005856 GO:0005886 GO:0005938 GO:0006351 GO:0006355 GO:0006366 GO:0006810 GO:0007165 GO:0008360 GO:0008652 GO:0010691 GO:0016020 GO:0016459 GO:0030027 GO:0030705 GO:0030898 GO:0031527 GO:0032433 GO:0042802 GO:0042995 GO:0043565 GO:0045899 GO:0051015 GO:0051489 GO:0060002 GO:0060261 GO:1903833
8	0.37	0.941	0.37	0.15	1.00	2b9cB	GO:0003779 GO:0005737 GO:0005856 GO:0006936 GO:0030049 GO:0030336 GO:0031529 GO:0032781 GO:0042060 GO:0042803 GO:0043234 GO:0043462 GO:0045785 GO:0047485 GO:0051015 GO:0051496 GO:0051693 GO:0060048
9	0.37	0.892	0.52	0.12	1.00	2xzrA	GO:0009405 GO:0019867
10	0.35	0.936	0.39	0.03	1.00	5dolB	GO:0006260
11	0.34	0.872	0.61	0.09	1.00	5aptB	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
12	0.31	0.898	0.51	0.00	1.00	3q8tB	GO:0000045 GO:0000407 GO:0000910 GO:0001666 GO:0005634 GO:0005737 GO:0005739 GO:0005768 GO:0005776 GO:0005783 GO:0005789 GO:0005794 GO:0005802 GO:0006897 GO:0006914 GO:0006915 GO:0006995 GO:0007040 GO:0007049 GO:0007080 GO:0008285 GO:0010008 GO:0010508 GO:0016020 GO:0016023 GO:0016236 GO:0016239 GO:0019898 GO:0030425 GO:0031410 GO:0031625 GO:0031966 GO:0032258 GO:0032465 GO:0032801 GO:0033197 GO:0034271 GO:0034272 GO:0035032 GO:0042149 GO:0042493 GO:0043066 GO:0043234 GO:0043548 GO:0043652 GO:0044804 GO:0045324 GO:0045335 GO:0048666 GO:0050435 GO:0050790 GO:0051301 GO:0051607 GO:0051707 GO:0060548 GO:0071275 GO:0071364 GO:0098779 GO:1902425 GO:1903599 GO:2000378
13	0.31	0.846	0.66	0.09	1.00	1kqlA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
14	0.28	0.898	0.54	0.06	1.00	2ynyA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0009405 GO:0010691 GO:0019867 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
15	0.26	0.849	1.30	0.09	1.00	3ck4C	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
16	0.26	0.895	0.53	0.06	1.00	2yo3B	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0009405 GO:0010691 GO:0019867 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
17	0.24	0.887	0.55	0.09	1.00	1c1gA	GO:0003779 GO:0005737 GO:0005856
18	0.24	0.896	0.54	0.09	1.00	4g2kA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039654 GO:0039663 GO:0042802 GO:0043565 GO:0045899 GO:0046718 GO:0055036 GO:0060261 GO:1903833
19	0.23	0.903	0.52	0.09	1.00	3wprA	GO:0009405 GO:0019867
20	0.21	0.913	0.47	0.06	1.00	2x7rC	GO:0002223 GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0019064 GO:0019082 GO:0020002 GO:0030683 GO:0033644 GO:0039654 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036 GO:0075509 GO:0075512
21	0.19	0.901	0.51	0.09	1.00	5apzA	GO:0000122 GO:0000790 GO:0000978 GO:0000981 GO:0001080 GO:0001084 GO:0001135 GO:0001190 GO:0001191 GO:0003677 GO:0003682 GO:0003700 GO:0005634 GO:0005667 GO:0006351 GO:0006355 GO:0006366 GO:0008652 GO:0010691 GO:0042802 GO:0043565 GO:0045899 GO:0060261 GO:1903833
22	0.08	0.882	0.59	0.00	1.00	3p30A
23	0.07	0.897	0.52	0.06	1.00	3k9aA
24	0.07	0.861	0.65	0.00	1.00	3cp1A	GO:0005198 GO:0019031
25	0.07	0.876	0.56	0.12	1.00	3wfvA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
26	0.07	0.896	0.52	0.06	1.00	1qbzA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036
27	0.07	0.900	0.51	0.15	1.00	2ezoA	GO:0005198 GO:0016020 GO:0016021 GO:0016032 GO:0019012 GO:0019031 GO:0019062 GO:0020002 GO:0033644 GO:0039663 GO:0044174 GO:0044175 GO:0046718 GO:0055036

Consensus prediction of GO terms

Molecular Function	GO:0003682	GO:0001190	GO:0001084	GO:0001135	GO:0000981	GO:0042802	GO:0000978	GO:0003779
GO-Score	0.88	0.88	0.88	0.88	0.88	0.88	0.88	0.40
Biological Processes	GO:0001080	GO:0008652	GO:1903833	GO:0010691	GO:0045899	GO:0009405
GO-Score	0.88	0.88	0.88	0.88	0.88	0.40
Cellular Component	GO:0000790	GO:0005667	GO:0005737	GO:0005856	GO:0019867
GO-Score	0.88	0.88	0.40	0.40	0.40

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.

I-TASSER results for job id Rv0500B

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]