I-TASSER results

I-TASSER results for job id Rv0381c

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Input Sequence in FASTA format

>protein (302 residues)
MRILVAWATCGAVVLSGLTGCSGSSHSGRTYGAQSARTGESLAVLGWNMSVSNLRWSGDY
VLIDVDASPTDPHAPHAKPEDIRFGLYGALAHPMESAALGSCGDAMAHVRDVVSPLSAPA
GRLTGTVCLGPLKERSAVRGVYTYSPRDRIPGTAAAYPAAFPVGMLPTNQNDAGLVVKTT
SVSAWRADGMQLGKPQLGDPVAFTGNGYMLLGLEVDAVPDRYRDDSAARGGPMMLLAAPT
LPGRGLSPACATYGSSVLILPDALLDAVHISASLCTQGEINEALLYATVATVGTHAALWT
SR

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 140 160 180 200 220 240 260 280 300 \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| MRILVAWATCGAVVLSGLTGCSGSSHSGRTYGAQSARTGESLAVLGWNMSVSNLRWSGDYVLIDVDASPTDPHAPHAKPEDIRFGLYGALAHPMESAALGSCGDAMAHVRDVVSPLSAPAGRLTGTVCLGPLKERSAVRGVYTYSPRDRIPGTAAAYPAAFPVGMLPTNQNDAGLVVKTTSVSAWRADGMQLGKPQLGDPVAFTGNGYMLLGLEVDAVPDRYRDDSAARGGPMMLLAAPTLPGRGLSPACATYGSSVLILPDALLDAVHISASLCTQGEINEALLYATVATVGTHAALWTSR
Prediction	CHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCEEEEEEEEEHCCEEEEHCCCCCCCCCCCCCCHHHCEEEHCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCEEEEEHCCCCCCCCCCEEEEHCCCCCCCCCCCHCCCCCCCCCCCCCCCCCCEEEEEHCEEEEHCCCCCCCHHHCCCCCCCCCCCEEEEEEHCCCHHHHHHHHHHHHCCCEEEEHCCCCCCCCCCHHHHHHCCEEEHCCCCCCCCEHCCCEEEHCCHHHHHHHHEEEEEEEEEEEEEHCC
Conf.Score	93466899999999999765689998888666665555643333465567666788788799985688888899999956654555455568765677776665445665455568899987556777556765443344787676568998754444446656789999898589998553456468887887777886546788679998764445677777788879978998757899999985566658758985654454444664455455577777653467776555666589
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 140 160 180 200 220 240 260 280 300 \| \| \| \| \| \| \| \| \| \| \| \| \| \| \| MRILVAWATCGAVVLSGLTGCSGSSHSGRTYGAQSARTGESLAVLGWNMSVSNLRWSGDYVLIDVDASPTDPHAPHAKPEDIRFGLYGALAHPMESAALGSCGDAMAHVRDVVSPLSAPAGRLTGTVCLGPLKERSAVRGVYTYSPRDRIPGTAAAYPAAFPVGMLPTNQNDAGLVVKTTSVSAWRADGMQLGKPQLGDPVAFTGNGYMLLGLEVDAVPDRYRDDSAARGGPMMLLAAPTLPGRGLSPACATYGSSVLILPDALLDAVHISASLCTQGEINEALLYATVATVGTHAALWTSR
Prediction	53010000010000000022034565553323243241342101121302023031434100000313255685451426402100110012215151223144234434421431534543020100002345423030001113443146332321001100001147532001033431521334444144441332621213000000020522254145433641100000001212254132302211000000031235215042201331302300010101111210112368
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Normalized B-facotr

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. (Click here to read more about predicted normalized B-factor)

Top 10 threading templates used by I-TASSER

Rank

PDB
Hit

Iden1

Iden2

Cov

Norm.
Zscore

Download
Align.

                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300

                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |

Sec.Str
Seq

CHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCEEEEEEEEEHCCEEEEHCCCCCCCCCCCCCCHHHCEEEHCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCEEEEEHCCCCCCCCCCEEEEHCCCCCCCCCCCHCCCCCCCCCCCCCCCCCCEEEEEHCEEEEHCCCCCCCHHHCCCCCCCCCCCEEEEEEHCCCHHHHHHHHHHHHCCCEEEEHCCCCCCCCCCHHHHHHCCEEEHCCCCCCCCEHCCCEEEHCCHHHHHHHHEEEEEEEEEEEEEHCC
MRILVAWATCGAVVLSGLTGCSGSSHSGRTYGAQSARTGESLAVLGWNMSVSNLRWSGDYVLIDVDASPTDPHAPHAKPEDIRFGLYGALAHPMESAALGSCGDAMAHVRDVVSPLSAPAGRLTGTVCLGPLKERSAVRGVYTYSPRDRIPGTAAAYPAAFPVGMLPTNQNDAGLVVKTTSVSAWRADGMQLGKPQLGDPVAFTGNGYMLLGLEVDAVPDRYRDDSAARGGPMMLLAAPTLPGRGLSPACATYGSSVLILPDALLDAVHISASLCTQGEINEALLYATVATVGTHAALWTSR

3hxjA

0.14

0.13

0.91

0.66

MUSTER

IDSSPILAKNGTIYLGSLYAINTDGSVKWFFKSGEIIECR--PSIGKDGTIY---GSDKVYAINPDGTERFDTSDFTIFEDILYVTSDGHLYAINTDG-TEKWRFKTKKAIYATPIVSED----GTIYVG-----SNDNYLYAINPDGTE---KWRFKTNDAITSAASIGKDGTIYFGSDKVYAINPDGTEKWNFYAGYWTAISEDGTIYVTSL-DGHLYAINPDGTEKGKR--IESSPVIGNTDTIYFGSYDG-HLYAIPDGTE-NFETGSWIIATPVIDNGTIYFGTR--GKFYALFN--

5gaoE

0.15

0.14

0.93

0.76

dPPAS

AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA----AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA-----AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA-------------AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAARAAAAAAAAAAAAAAAAAAAAAAAAA

2qc5A

0.12

0.09

0.78

0.51

wdPPAS

---------------------SEAWMNFYLFNLSIPDSGYGITS-G-KVWFTQ----KANKISSLDQSGREVPTPDAKVMCLIVGIWNKIGK-LSKKG------EYPLPQPDSGPITEGLN---GDIWFT---QLNG-DRIGKLTADGTIYEYDLPNKGSYPAFI----GSDNALWFTENQIGRITNTGKLELPTNAAAPVTSGNDGALWFVEIMGNKIGRITTT-----GEISEYDIPARP--AI--TAGKNSE-IWF--EWGANQIGR-----NDNTIQEYQLQTGITF-GS---VWFAL

3hxjA

0.16

0.13

0.84

0.57

wMUSTER

-----------------IGNSSSPAKNGTIYGSSNKNLGS---VK-WEIIECRPSIGKDVYAINPDGTERFDTSDFTIFEDILYVTSDGHLYAINTDG-TEKWRFKTKKAIYATPIVS-ED---GTIYVG-----SNDNYLYAINPDG---TEKWRFKTNDAITSAASIGKDGTIYFGSDKVYAINPDGTEKWNFYAGYWTAISEDGTIYVTSL-DGHLYAINPDGTEKGKR--IESSPVIGNTDTIYFGSYDG-HLYAIPDGTESWIIATPVIDENG-----TIYFGTR--GKFYALFN--

2vowA

0.33

0.24

0.72

0.48

wPPAS

INFKIA---------------SPPGPGTPIYGPPRDFSG-SLAI-GWNITVSD-IWRGDKITLSVDAQEASLKGAH--P---GFILF----RP-EGGPLAGTQDLDE------GQTALPAD--SDTV-IGHVIVQHALQGL---PPKDH---TA---PAGVDTELYPMKP-DS-YTMYYV-DSGYDADKYVASKKLIMHPTAFKG-----LALN-DGTA----------G---AFTKSITLPKTGL------YVANVLEVDDWSVDA---DGKLTTTGEV-------EVPAKGCWVNITISK

3hxjA

0.15

0.12

0.79

0.84

dPPAS2

EIIECRPS-------------IGKDGTIYFGSDKVYAINPDGTEK-WRFDTSDFTIFEDILYVTSDG-----------------HLYA-----INTD--GTEKWRFKTKKAIYATPIVSED---GTIYVG-----SNDNYLYAINPD----GTEKRFKTNDAITSAASIGKDGTIYFGSDKVYAINPDGTEKWNFYAGYWTAISEDGTIYVTSLDGHLYAINPD-----GTEKWRFKSPVIGNTDTIYFGSYDGHLYAINPDGTESWIIATPVIDENGTI------YFGTRNGKFYALFN--

3hxjA

0.15

0.14

0.88

0.61

PPAS

IDSSPILAK------TIYLGSSNKN---NTDGSVFFKSGEIIPSIGKDGTIY--FGSDKVYAINPDGTERFDTSDFTIFEDILYVTSDGHLYAINTDG-TEKWRFKTKKAIYATPIVSE----DGTIYVG-----SNDNYLYAINPD----GTEKRFKTNDAITSAASIGKDGTIYFGSDKVYAINPDGTEKWNFYAGYWTAISEDGTIYVTSLDGHLYAINPD-RFKTGKR--IESSPVIGNTDTIYFGSYDG-HLYAI-NPDGTEKW---NFETGSWIIATTIYFGTR--GKFYALFN--

5b57C

0.22

0.14

0.63

0.64

Env-PPAS

--------------------------------------------M---LTAHHLDVAHGTILRDLSLS-IEPGR--------VTALLG----R---NGAGKT---FAGEL----TGSVAGVRVTGDVTLG--------EPLARIDAPRL----------ACLRAVLPAAQPAFPFSVDARRSGATSHRDRDIAWRAL----ERAG---------ADALVGRDVTTS---GGRYLLLDEPTT----VRAVAREWQGVLAIVHDAARDAIAMDGTIVAHGDVTPAHIA---QCYGFAVKMVETG

3u4yA

0.09

0.95

0.62

MUSTER

TSNFGIVVEQHLRRISFF---TDTLEILNQITLGYDFVD--TAI-CSNVVVTSD-FCQTLVQIETQLEPPKVVQEGQSSADVDITPDDQFAVTVTGLNHPFNQSYSFLKNKFISTIPIPYD--AVGIAISPNRSSANTVRRFKIDADGVLTGQEFISGGTRPFNITFTPDGNFAFVANLIGIGILEQNPENITLLNAVGTNVVSRDGTVYVLTESTVDVFNF---NQLSG--TLSFVKSF--GHGLLIDRPLFGANQALNKTETKLFISANISRELKFTISGKVVGYVAGIEANGIAICHPD

3hxjA

0.13

0.12

0.91

0.73

dPPAS

FLIGNSIDSSPILAKNGTIYLGSSNKNLYAINTDGSVKSGEIIECRPSIGKDGTIYFGSDKVYAINPDGTFDTSDFTIFEDILYVTSDGHLYAINTDG-----TEKWRFKTKKAIYATPIVSEDGTIYVG-----SNDNYLYAINPDGTE---KWRFKTNDAITSAASIGKDGTIYFGSDKVYAINPDGTEKWNFYAGYWTAISEDGTIYVTSLDGHLYAINPD-----GTEKWRFKSPVIGNTDTIYFGSYDGHLYAINPDGTESWIIATPVIDENGTI------YFGTRNGKFYALFN--

(a)	Iden1 is the number of template residues identical to query divided by number of aligned residues.
(b)	Iden2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment.
(e)	Download Align. list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.

Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of higher value signifies a model with a high confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated. This is usually an indication that the models have a good quality because of the converged simulations.)

More about C-score

Local structure accuracy of first model

Download Model 1

C-score=-3.68

Estimated TM-score = 0.31±0.10

Estimated RMSD = 15.3±3.4Å

Download Model 2

C-score=-5.00

Download Model 3

C-score=-5.00

Download Model 4

C-score=-5.00

Download Model 5

C-score=-4.62

Proteins structureally close to the target in PDB (as identified by TM-align

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)

Top 10 Identified stuctural analogs in PDB

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov
1	3hxjA	0.685	4.20	0.101	0.884
2	1yiqA	0.640	4.39	0.088	0.844
3	4maeA	0.640	4.38	0.069	0.844
4	1kb0A1	0.634	4.56	0.057	0.858
5	2d0vA	0.634	4.26	0.049	0.838
6	1kv9A1	0.634	4.57	0.068	0.858
7	1flgA	0.634	4.56	0.089	0.861
8	4cvbA	0.631	4.58	0.075	0.858
9	1r5mA	0.619	4.51	0.069	0.821
10	4zn4A	0.618	4.63	0.081	0.831

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted function using COACH

(This section reports biological annotations of the target protein by COACH based on the I-TASSER structure prediction. COACH is a meta-server approach that combines multiple function annotation results from the COFACTOR, TM-SITE and S-SITE programs.)

Ligand binding sites

Rank	C-score	Cluster size	PDB Hit	Lig Name	Download Complex	Ligand Binding Site Residues
1	0.09	5	1hj4B	DHE	Rep, Mult	165,166,168,201,202,214,237,238,239,278
2	0.07	4	4agiC	SFU	Rep, Mult	128,141,150,152,153,175,185,191
3	0.06	3	4rku4	CLA	Rep, Mult	281,284
4	0.02	1	3p1lA	NA	Rep, Mult	134,135,153,156
5	0.02	1	1hzuA	DHE	Rep, Mult	112,113,115,164,167,201,203,237
6	0.02	1	3anuA	ZN	Rep, Mult	269,275
7	0.02	1	3b8iB	MG	Rep, Mult	64,66
8	0.02	1	3cisB	MG	Rep, Mult	199,280
9	0.02	1	2ddsB	CO	Rep, Mult	48,95
10	0.02	1	2b0qA	MG	Rep, Mult	199,216
11	0.02	1	1m32A	PLP	Rep, Mult	203,204
12	0.02	1	3bwxA	CA	Rep, Mult	200,202
13	0.02	1	3ia7A	CA	Rep, Mult	274,279
14	0.02	1	3jb9L	NUC	Rep, Mult	139,159,194,196,224
15	0.02	1	1dwaM	MAN	Rep, Mult	277,280
16	0.02	1	1pjxA	DXE	Rep, Mult	62,297,298
17	0.02	1	3lotA	UNL	Rep, Mult	67,92,130
18	0.02	1	3lv4A	CA	Rep, Mult	167,295

	Download the all possible binding ligands and detailed prediction summary.
	Download the templates clustering results.
(a)	C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)	Cluster size is the total number of templates in a cluster.
(c)	Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)	Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column. Mult is the complex structures with all potential binding ligands in the cluster.

Enzyme Commission (EC) numbers and active sites

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov	EC Number	Active Site Residues
1	0.060	3gvjA	0.535	5.37	0.052	0.785	3.2.1.129	262
2	0.060	1w6sC	0.631	4.46	0.077	0.841	1.1.99.8	NA
3	0.060	2ebsB	0.554	5.16	0.086	0.801	3.2.1.150	NA
4	0.060	2h47H	0.546	4.71	0.078	0.765	1.4.99.4	NA
5	0.060	2gc7A	0.549	4.54	0.089	0.745	1.4.99.3	121
6	0.060	1r9mB	0.451	5.25	0.055	0.662	3.4.14.5	NA
7	0.060	1kitA	0.552	5.89	0.067	0.874	3.2.1.18	NA
8	0.060	1kb0A	0.634	4.56	0.057	0.858	1.1.99.-	NA
9	0.060	1fwxA	0.573	4.42	0.069	0.765	1.7.99.6	127,152
10	0.060	2madH	0.546	4.57	0.062	0.748	1.4.99.3	169
11	0.060	1lrwC	0.634	4.50	0.068	0.851	1.1.99.8	NA
12	0.060	2w68C	0.246	5.66	0.064	0.371	3.2.1.18	177,188
13	0.060	2gbcA	0.468	5.12	0.046	0.652	3.4.14.5,3.4.15.5	NA
14	0.060	2jkbA	0.514	5.60	0.034	0.771	3.2.1.18,4.2.2.15	NA
15	0.060	2d5lA	0.515	5.19	0.055	0.735	3.4.14.-	NA
16	0.060	3elqB	0.565	5.41	0.053	0.828	2.8.2.22	189
17	0.060	1g72A	0.630	4.64	0.079	0.854	1.1.99.8	6,146
18	0.060	2d0vA	0.634	4.26	0.049	0.838	1.1.99.8	NA
19	0.060	1ri6A	0.579	4.35	0.063	0.768	3.1.1.31	NA

(a)	Cscore^EC is the confidence score for the EC number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Gene Ontology (GO) terms

Rank	Cscore^GO	TM-score	RMSD^a	IDEN^a	Cov	PDB Hit	Associated GO Terms
Homologous GO templates in PDB
0	0.15	0.581	4.36	0.07	0.76	4pk1A	GO:0007155 GO:0009279 GO:0016020 GO:0016021 GO:0019867 GO:0042802 GO:0043165 GO:0051205 GO:0071709 GO:1990063
1	0.12	0.578	4.57	0.07	0.78	3jb9K	GO:0000974 GO:0005634 GO:0005662 GO:0005681 GO:0006397 GO:0008380 GO:0045292 GO:0071011 GO:0071013 GO:0080008
2	0.11	0.640	4.39	0.09	0.84	1yiqA	GO:0005509 GO:0009055 GO:0016020 GO:0016491 GO:0016614 GO:0020037 GO:0042597 GO:0046872 GO:0055114 GO:0070968
3	0.08	0.634	4.57	0.07	0.86	1kv9A	GO:0005509 GO:0009055 GO:0016020 GO:0016491 GO:0016614 GO:0020037 GO:0030288 GO:0042597 GO:0046872 GO:0055114 GO:0070968
4	0.08	0.581	4.77	0.07	0.78	4aahA	GO:0005509 GO:0005886 GO:0015945 GO:0016020 GO:0016491 GO:0016614 GO:0030288 GO:0046872 GO:0052930 GO:0052931 GO:0052932 GO:0052933 GO:0055114
5	0.08	0.634	4.56	0.09	0.86	1flgA	GO:0005509 GO:0006069 GO:0016020 GO:0016491 GO:0016614 GO:0018468 GO:0030288 GO:0042597 GO:0046872 GO:0052934 GO:0052935 GO:0052936 GO:0055114
6	0.08	0.640	4.38	0.07	0.84	4maeA	GO:0005509 GO:0016020 GO:0016491 GO:0016614 GO:0052930 GO:0052931 GO:0052932 GO:0052933 GO:0052934 GO:0052935 GO:0052936 GO:0055114
7	0.07	0.631	4.65	0.08	0.86	1lrwA	GO:0005509 GO:0015945 GO:0016020 GO:0016491 GO:0016614 GO:0030288 GO:0042597 GO:0046872 GO:0052930 GO:0052931 GO:0052932 GO:0052933 GO:0055114
8	0.07	0.637	4.43	0.09	0.84	4tqoA	GO:0005509 GO:0015946 GO:0016020 GO:0016614 GO:0018468 GO:0030288 GO:0046872 GO:0055114
9	0.07	0.631	4.46	0.08	0.84	1w6sC	GO:0005509 GO:0005886 GO:0015945 GO:0016020 GO:0016491 GO:0016614 GO:0030288 GO:0046872 GO:0052930 GO:0052931 GO:0052932 GO:0052933 GO:0055114
10	0.07	0.598	4.69	0.12	0.81	4hdjA	GO:0009279 GO:0016020 GO:0043165 GO:0051205
11	0.07	0.634	4.26	0.05	0.84	2d0vA	GO:0005509 GO:0016020 GO:0016614 GO:0030288 GO:0046872 GO:0055114
12	0.07	0.631	4.58	0.07	0.86	4cvbA	GO:0046872
13	0.07	0.635	4.55	0.06	0.86	1kb0A	GO:0005509 GO:0009055 GO:0016020 GO:0016491 GO:0016614 GO:0020037 GO:0030288 GO:0042597 GO:0046872 GO:0055114
14	0.07	0.591	4.53	0.07	0.79	1gjqA	GO:0009055 GO:0016491 GO:0020037 GO:0042597 GO:0046872 GO:0050418 GO:0050421 GO:0055114
15	0.07	0.589	4.35	0.09	0.78	4immA	GO:0009279 GO:0016020 GO:0043165 GO:0046872 GO:0051205
16	0.07	0.587	4.45	0.06	0.78	3jcrL	GO:0000375 GO:0000398 GO:0005634 GO:0005654 GO:0005681 GO:0006396 GO:0006397 GO:0008380 GO:0015030 GO:0016607 GO:0017070 GO:0030621 GO:0046540 GO:0071001 GO:0097525
17	0.07	0.607	4.49	0.10	0.80	4v6iAa	GO:0001403 GO:0001965 GO:0004871 GO:0005092 GO:0005737 GO:0007186 GO:0010255 GO:0017148 GO:0022627 GO:0050790 GO:2001125
18	0.07	0.589	4.69	0.06	0.80	4v6wAg	GO:0000398 GO:0005080 GO:0005737 GO:0005776 GO:0005829 GO:0005875 GO:0007626 GO:0009267 GO:0016243 GO:0018991 GO:0035220 GO:0042335 GO:0044829 GO:0045725 GO:0046716 GO:0048477 GO:0071011 GO:0071013 GO:0075522
19	0.07	0.565	5.04	0.04	0.80	1yfqA	GO:0000778 GO:0005634 GO:0007049 GO:0007094 GO:0033597 GO:0043130 GO:0044774 GO:1990298
20	0.07	0.586	4.78	0.09	0.80	5it9g	GO:0000747 GO:0001403 GO:0001965 GO:0004871 GO:0005080 GO:0005092 GO:0005737 GO:0007186 GO:0010255 GO:0017148 GO:0022627 GO:0031139 GO:0031954 GO:0032995 GO:0034613 GO:0035556 GO:0043022 GO:0050790 GO:0060733
21	0.07	0.563	4.87	0.05	0.79	3ow8C	GO:0005634 GO:0005654 GO:0005737 GO:0006351 GO:0006355 GO:0016055 GO:0016593 GO:0032968 GO:0035327 GO:0045638 GO:0045944 GO:0051571 GO:0055087 GO:0080182 GO:2001162
22	0.07	0.562	4.73	0.06	0.77	3jb9L	GO:0005634 GO:0005681 GO:0005682 GO:0006397 GO:0008380 GO:0045292
23	0.07	0.580	4.73	0.05	0.81	5a9q2	GO:0000775 GO:0000776 GO:0000777 GO:0005634 GO:0005635 GO:0005643 GO:0005654 GO:0005694 GO:0005829 GO:0006406 GO:0006409 GO:0006810 GO:0007049 GO:0007059 GO:0007062 GO:0007067 GO:0007077 GO:0010827 GO:0015031 GO:0016032 GO:0016925 GO:0019083 GO:0031047 GO:0031080 GO:0051028 GO:0051301 GO:0075733 GO:1900034
24	0.07	0.560	4.93	0.05	0.79	4g56D	GO:0005634 GO:0005737 GO:0005829 GO:0034709 GO:0035097
25	0.07	0.575	4.51	0.05	0.76	5flcD	GO:0005654 GO:0005737 GO:0005829 GO:0007050 GO:0016236 GO:0030838 GO:0031295 GO:0031931 GO:0031932 GO:0032008 GO:0032956 GO:0043087 GO:0048015 GO:0050731 GO:1900034
26	0.07	0.619	4.51	0.07	0.82	1r5mA	GO:0003714 GO:0005634 GO:0006355 GO:0006357 GO:0016568 GO:0016575 GO:0031939 GO:0032874 GO:0034967 GO:0045835 GO:1903507
27	0.07	0.587	4.70	0.07	0.80	5a2qg	GO:0001649 GO:0001891 GO:0001934 GO:0005080 GO:0005102 GO:0005634 GO:0005737 GO:0005739 GO:0005829 GO:0005886 GO:0005913 GO:0006417 GO:0006915 GO:0006919 GO:0007049 GO:0007275 GO:0007369 GO:0008200 GO:0008656 GO:0010629 GO:0010803 GO:0015935 GO:0016020 GO:0016032 GO:0017148 GO:0019899 GO:0019903 GO:0030178 GO:0030292 GO:0030308 GO:0030335 GO:0030425 GO:0030496 GO:0030822 GO:0030971 GO:0032436 GO:0032464 GO:0032880 GO:0032947 GO:0033137 GO:0035591 GO:0040008 GO:0042169 GO:0042803 GO:0042995 GO:0042998 GO:0043005 GO:0043025 GO:0043065 GO:0043204 GO:0043547 GO:0044297 GO:0044822 GO:0048471 GO:0048511 GO:0050765 GO:0051302 GO:0051343 GO:0051726 GO:0051898 GO:0051901 GO:0061099 GO:0070062 GO:0071333 GO:0071363 GO:0090003 GO:0098609 GO:0098641 GO:1900102 GO:1903208 GO:1990630 GO:2000114 GO:2000304 GO:2000543 GO:2001244
28	0.07	0.610	4.53	0.06	0.81	4lg9A	GO:0000118 GO:0000122 GO:0002021 GO:0003677 GO:0003714 GO:0005634 GO:0005654 GO:0005876 GO:0006351 GO:0006355 GO:0008013 GO:0010468 GO:0016042 GO:0016568 GO:0016575 GO:0017053 GO:0030814 GO:0035264 GO:0042393 GO:0043161 GO:0044212 GO:0044255 GO:0045892 GO:0045893 GO:0045944 GO:0047485 GO:0050872 GO:0060070 GO:0060612 GO:0060613 GO:0090207
29	0.07	0.566	4.98	0.07	0.80	5emkB	GO:0000387 GO:0005634 GO:0005654 GO:0005737 GO:0005794 GO:0005829 GO:0006357 GO:0008284 GO:0008285 GO:0008327 GO:0016274 GO:0030374 GO:0034709 GO:0035246 GO:0060528 GO:0060770
30	0.07	0.578	4.60	0.06	0.78	5hqgA	GO:0000139 GO:0004842 GO:0005634 GO:0005654 GO:0005737 GO:0005813 GO:0005829 GO:0005925 GO:0008270 GO:0010212 GO:0016567 GO:0016607 GO:0016874 GO:0032436 GO:0046872 GO:0061630
31	0.07	0.574	5.03	0.05	0.81	5igoC	GO:0000152 GO:0004842 GO:0005634 GO:0005737 GO:0006281 GO:0008270 GO:0009585 GO:0009640 GO:0009641 GO:0009647 GO:0009649 GO:0010017 GO:0010119 GO:0016567 GO:0016604 GO:0016874 GO:0032436 GO:0042802 GO:0046283 GO:0046872 GO:0048573 GO:0061630 GO:0080008
32	0.07	0.599	4.42	0.08	0.79	1erjC	GO:0000122 GO:0000123 GO:0000433 GO:0001191 GO:0001198 GO:0005634 GO:0006351 GO:0006355 GO:0007070 GO:0008023 GO:0016584 GO:0017053 GO:0033588 GO:0035955 GO:0036033 GO:0042393 GO:0042826 GO:0043486 GO:0080025 GO:2000217 GO:2000531 GO:2001020
33	0.07	0.564	4.60	0.10	0.76	4yvdA	GO:0000398 GO:0000974 GO:0005634 GO:0005654 GO:0005662 GO:0005681 GO:0005730 GO:0006397 GO:0008380 GO:0016607 GO:0031965 GO:0034504 GO:0071011 GO:0071013 GO:0080008 GO:1900087
34	0.07	0.594	4.89	0.09	0.82	4btsAR	GO:0005840
35	0.07	0.583	3.87	0.05	0.74	4aezA	GO:0000070 GO:0005634 GO:0007049 GO:0007067 GO:0010997 GO:0032153 GO:0033597 GO:0034613 GO:0044732 GO:0051301 GO:0072686 GO:0097027 GO:1904668
36	0.07	0.574	4.70	0.07	0.80	3pe7A	GO:0016829 GO:0045490 GO:0046872 GO:0047487
37	0.07	0.578	4.53	0.07	0.77	1vyhC	GO:0000132 GO:0000226 GO:0000235 GO:0000776 GO:0001667 GO:0001675 GO:0001764 GO:0001961 GO:0005634 GO:0005635 GO:0005737 GO:0005813 GO:0005815 GO:0005819 GO:0005829 GO:0005856 GO:0005871 GO:0005874 GO:0005875 GO:0005938 GO:0006629 GO:0006810 GO:0007017 GO:0007049 GO:0007067 GO:0007097 GO:0007268 GO:0007275 GO:0007399 GO:0007405 GO:0007420 GO:0007611 GO:0008017 GO:0008090 GO:0008344 GO:0009306 GO:0010977 GO:0015630 GO:0016020 GO:0016042 GO:0016477 GO:0017145 GO:0019226 GO:0021540 GO:0021766 GO:0021819 GO:0021895 GO:0021987 GO:0030036 GO:0030154 GO:0030424 GO:0030426 GO:0031023 GO:0031252 GO:0031512 GO:0031965 GO:0031982 GO:0032403 GO:0032420 GO:0036035 GO:0040019 GO:0042249 GO:0042803 GO:0043005 GO:0043025 GO:0043087 GO:0043622 GO:0045502 GO:0045505 GO:0045773 GO:0045931 GO:0046329 GO:0047496 GO:0048471 GO:0048854 GO:0050885 GO:0051081 GO:0051130 GO:0051219 GO:0051301 GO:0051660 GO:0051661 GO:0060117 GO:0061003 GO:0070062 GO:0070507 GO:0090102 GO:0090176 GO:1904115 GO:2000574
38	0.07	0.578	4.63	0.07	0.78	4j87A	GO:0000139 GO:0005198 GO:0005737 GO:0005794 GO:0006810 GO:0006886 GO:0006888 GO:0006890 GO:0006891 GO:0015031 GO:0016020 GO:0016192 GO:0030117 GO:0030126 GO:0030137
39	0.07	0.570	4.70	0.08	0.78	3jcrD	GO:0000375 GO:0000398 GO:0005634 GO:0005654 GO:0005681 GO:0005682 GO:0005732 GO:0005737 GO:0006396 GO:0006397 GO:0008380 GO:0044822 GO:0071011 GO:0071013
40	0.07	0.546	4.02	0.07	0.70	3fm0A	GO:0006357 GO:0007059 GO:0008284 GO:0016226 GO:0071817 GO:0097361
41	0.07	0.587	4.19	0.05	0.77	3gfcA	GO:0000790 GO:0000978 GO:0000980 GO:0004407 GO:0005634 GO:0005654 GO:0006260 GO:0006335 GO:0006336 GO:0006338 GO:0006351 GO:0006355 GO:0007049 GO:0008094 GO:0008285 GO:0016568 GO:0016575 GO:0016580 GO:0016581 GO:0016589 GO:0031492 GO:0031497 GO:0033186 GO:0034080 GO:0035098 GO:0042393 GO:0042826 GO:0043044 GO:0043234 GO:0045814 GO:0051726 GO:1901796
42	0.07	0.569	4.43	0.06	0.77	4lg8A	GO:0000209 GO:0000244 GO:0000245 GO:0000398 GO:0000974 GO:0001833 GO:0004842 GO:0005634 GO:0005654 GO:0005662 GO:0005681 GO:0005737 GO:0005811 GO:0005819 GO:0005856 GO:0006281 GO:0006283 GO:0006303 GO:0006397 GO:0006974 GO:0008380 GO:0008610 GO:0010498 GO:0016020 GO:0016567 GO:0016607 GO:0016874 GO:0034450 GO:0034613 GO:0035861 GO:0042802 GO:0045665 GO:0048026 GO:0048711 GO:0061630 GO:0070534 GO:0071013 GO:0072422
43	0.07	0.514	4.30	0.05	0.68	3eweA	GO:0005634 GO:0005643 GO:0005773 GO:0005774 GO:0006810 GO:0006913 GO:0015031 GO:0016020 GO:0017056 GO:0031080 GO:0031965 GO:0035859 GO:0051028 GO:0097042 GO:1904263
44	0.07	0.571	4.95	0.08	0.80	3w15A	GO:0005053 GO:0005737 GO:0005777 GO:0005829 GO:0006810 GO:0015031 GO:0016560
45	0.07	0.559	4.74	0.08	0.76	2hesX	GO:0002098 GO:0005634 GO:0005737 GO:0005829 GO:0016226 GO:0044281 GO:0097361
46	0.07	0.587	4.75	0.06	0.80	4a11B	GO:0000109 GO:0000209 GO:0003678 GO:0004842 GO:0005634 GO:0005654 GO:0006281 GO:0006283 GO:0006289 GO:0006974 GO:0006979 GO:0008094 GO:0009411 GO:0010165 GO:0016363 GO:0016567 GO:0031464 GO:0032403 GO:0043161 GO:0043234 GO:0045739 GO:0051865
47	0.07	0.598	4.59	0.08	0.80	4v3pSa	GO:0007165
48	0.07	0.568	4.82	0.06	0.78	2h9lA	GO:0000123 GO:0001501 GO:0005622 GO:0005634 GO:0005654 GO:0005671 GO:0006351 GO:0006355 GO:0016568 GO:0018024 GO:0031175 GO:0035064 GO:0035097 GO:0035948 GO:0042800 GO:0043966 GO:0043981 GO:0043982 GO:0043984 GO:0043995 GO:0043996 GO:0044666 GO:0046972 GO:0048188 GO:0051568 GO:0071339
49	0.07	0.582	4.85	0.05	0.80	3zwlD	GO:0001731 GO:0002183 GO:0002188 GO:0003743 GO:0005737 GO:0005852 GO:0006412 GO:0006413 GO:0006446 GO:0016282 GO:0033290 GO:0043614
50	0.07	0.581	4.32	0.08	0.76	2ce8A	GO:0000122 GO:0001106 GO:0005634 GO:0005654 GO:0005730 GO:0005737 GO:0005829 GO:0006351 GO:0006355 GO:0007165 GO:0007275 GO:0008134 GO:0009887 GO:0010628 GO:0016055 GO:0030178 GO:0042802 GO:0043124 GO:0045892 GO:1904837 GO:2000811
51	0.07	0.543	4.34	0.08	0.71	3odtA	GO:0005634 GO:0005737 GO:0006303 GO:0006511 GO:0010992 GO:0043130
52	0.07	0.565	4.11	0.11	0.74	4jxmA	GO:0003723 GO:0005634 GO:0005654 GO:0005730 GO:0006364 GO:0030529 GO:0031428 GO:0032040 GO:0034511 GO:0044822
53	0.07	0.577	4.61	0.09	0.77	1b9xA	GO:0001750 GO:0003924 GO:0004871 GO:0005622 GO:0005765 GO:0005834 GO:0007165 GO:0007186 GO:0007191 GO:0007200 GO:0008283 GO:0016020 GO:0016056 GO:0022400 GO:0032403 GO:0043209 GO:0050909 GO:0051020 GO:0060041 GO:0070062 GO:0071380 GO:0071870 GO:0097381 GO:1903561
54	0.07	0.517	5.09	0.04	0.73	3s25A	GO:0016020 GO:0016021

Consensus prediction of GO terms

Molecular Function	GO:0046872	GO:0046906	GO:0048038	GO:0031406	GO:0003824
GO-Score	0.50	0.37	0.37	0.37	0.35
Biological Processes	GO:0044710
GO-Score	0.50
Cellular Component	GO:0016020	GO:0030313
GO-Score	0.36	0.32

(a)	Cscore^GO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)	The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on Cscore^GO of the template.

[Click on result.tar.bz2 to download the tarball file including all modelling results listed on this page]

Please cite the following articles when you use the I-TASSER server:
1.	J Yang, R Yan, A Roy, D Xu, J Poisson, Y Zhang. The I-TASSER Suite: Protein structure and function prediction. Nature Methods, 12: 7-8, 2015.
2.	J Yang, Y Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.
3.	A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738, 2010.
4.	Y Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9: 40, 2008.